BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10c13 (460 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 32 0.26 SB_17568| Best HMM Match : Ldl_recept_a (HMM E-Value=0.04) 31 0.46 SB_7846| Best HMM Match : CoCoA (HMM E-Value=0.00016) 31 0.46 SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) 31 0.61 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 31 0.61 SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_41667| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.80 SB_28257| Best HMM Match : Gp-FAR-1 (HMM E-Value=3.2) 29 1.4 SB_23562| Best HMM Match : DUF288 (HMM E-Value=1.1) 29 1.4 SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_30472| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42) 29 1.8 SB_47491| Best HMM Match : Acyl-CoA_dh_N (HMM E-Value=0.36) 29 2.4 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 29 2.4 SB_21494| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_33744| Best HMM Match : SMC_N (HMM E-Value=0) 28 4.3 SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) 28 4.3 SB_58681| Best HMM Match : MAP65_ASE1 (HMM E-Value=3.3e-26) 28 4.3 SB_45217| Best HMM Match : Linker_histone (HMM E-Value=4.4e-27) 28 4.3 SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 27 5.6 SB_45585| Best HMM Match : Swi3 (HMM E-Value=0.37) 27 5.6 SB_6594| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_58221| Best HMM Match : TBC (HMM E-Value=2.9e-08) 27 5.6 SB_36059| Best HMM Match : TolA (HMM E-Value=0.1) 27 5.6 SB_35264| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_19757| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 27 5.6 SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) 27 7.5 SB_47152| Best HMM Match : Vicilin_N (HMM E-Value=5.4) 27 7.5 SB_36416| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_810| Best HMM Match : TAF4 (HMM E-Value=4.7e-31) 27 7.5 SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_8891| Best HMM Match : Zot (HMM E-Value=2.5) 27 9.9 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 27 9.9 SB_43667| Best HMM Match : EHN (HMM E-Value=4.3) 27 9.9 SB_22025| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.12) 27 9.9 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 31.9 bits (69), Expect = 0.26 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = +1 Query: 214 LREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 LR+ E KEK +AK +EKER A + K E + K+ K+K Sbjct: 322 LRQKEEKEKQRLEAKAAKEKERLEAKQKKEQERLEKQAEKEKKEK 366 Score = 26.6 bits (56), Expect = 9.9 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 184 QNRLSKKEAKLRE-IEAKEKVIRDAKLKEEKERASALEIKALEE 312 + RL KK+ + ++ +E KEK + + KEE+ A E K EE Sbjct: 366 KERLEKKQREEKDRLEKKEKKEEEKRKKEEEINAKIEEKKKREE 409 >SB_17568| Best HMM Match : Ldl_recept_a (HMM E-Value=0.04) Length = 189 Score = 31.1 bits (67), Expect = 0.46 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = +1 Query: 205 EAKLREIE-AKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 E + EIE AK+K + D +L+ E+++ E++A ++ K+ KDK Sbjct: 134 EKRRHEIELAKQKKLEDLRLQLEQKKQVVAELQATKDKVEAVEKEAKDK 182 >SB_7846| Best HMM Match : CoCoA (HMM E-Value=0.00016) Length = 1284 Score = 31.1 bits (67), Expect = 0.46 Identities = 19/54 (35%), Positives = 32/54 (59%) Frame = +1 Query: 175 AFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK 336 A HQ ++SK + L E + +RD +L +EKE AS++++ LE+ A +K Sbjct: 696 AHHQQKISKLNSCLEEAVSDMNSLRD-ELNKEKEAASSMKM-TLEKKAKEALEK 747 >SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) Length = 1217 Score = 30.7 bits (66), Expect = 0.61 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALE-EMASGTAKK 336 ++R +K+ ++ E + +E+ ++ K KEEKER E +A E E A AK+ Sbjct: 747 KDRKERKKIEMEEAKKREQEEKERKEKEEKERIEREEREAKEREYAERIAKQ 798 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 30.7 bits (66), Expect = 0.61 Identities = 12/43 (27%), Positives = 28/43 (65%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 Q + ++E ++RE E ++K +++ ++++ +E A +ALEE Sbjct: 176 QEQQEEEERRIREEEERQKALKEERMRKLQEEARLAAQRALEE 218 >SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1126 Score = 30.7 bits (66), Expect = 0.61 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEI--KALEEMASGTAKK 336 ++E +L+ E K ++ R+ ++EE+ER LE+ K +EE A K Sbjct: 963 RRERELKAREEKLRLAREQMMREERERTLKLELERKRMEERLKDQASK 1010 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIR-DAKLKEEKER 279 + R +K ++EIE KEK + K KEEKER Sbjct: 911 RERTEEKARIMKEIEEKEKKEEAERKAKEEKER 943 >SB_41667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 30.3 bits (65), Expect = 0.80 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 8/59 (13%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKAL-----EEMA---SGTAKK*KDKI 351 +KE KL E +AKE + A ++E++R ALE + L E++A + AKK K+K+ Sbjct: 259 EKERKLAEKKAKEDAAKAAAEEKERQRQEALEAERLAKEKEEQLAKEKATQAKKEKEKL 317 >SB_28257| Best HMM Match : Gp-FAR-1 (HMM E-Value=3.2) Length = 497 Score = 29.5 bits (63), Expect = 1.4 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDKIV 354 QN S+K R++ K V + A +++EK R + + +E + T K KD+IV Sbjct: 153 QNEASEKSGDARQV--KRSVDKKASVRDEKNRHDEDKKQTEKEEGADTNKAPKDRIV 207 >SB_23562| Best HMM Match : DUF288 (HMM E-Value=1.1) Length = 411 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = -3 Query: 188 FWWKAPYRTPTVRK--DQRPNLIRG-DIRTG 105 +WW++PY P R+ +Q NL G D+ TG Sbjct: 246 YWWRSPYGLPNCRRAYEQLSNLTLGHDLSTG 276 >SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 29.5 bits (63), Expect = 1.4 Identities = 19/55 (34%), Positives = 31/55 (56%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 Q+ + +E+K RE + KEK R+ +L+ +KER + K EE KK K++ Sbjct: 974 QSEVDAEESKKREKKDKEKEKRERELQRKKER-DEQKRKKEEEKREREEKKRKEE 1027 >SB_30472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 29.1 bits (62), Expect = 1.8 Identities = 22/64 (34%), Positives = 35/64 (54%) Frame = +1 Query: 157 VGVLYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK 336 +G+L ++ + EA+ + I KEK +AK +EE+ER E K E A+ A+K Sbjct: 295 IGMLKVLLNKGMTAVAEAEQKGI--KEKAETEAKKQEEEERKRDEEKKKAER-AAAEARK 351 Query: 337 *KDK 348 K+K Sbjct: 352 KKEK 355 >SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42) Length = 1712 Score = 29.1 bits (62), Expect = 1.8 Identities = 16/43 (37%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Frame = +1 Query: 166 LYGAFHQNRLSKKEAKLR-EIEAKEKVIRDAKLKEEKERASAL 291 L F + +S+K+ +L E++A+EK ++ KLK EKE+++ L Sbjct: 76 LVAKFQEEAVSEKQNRLSAELQAQEK-LQIEKLKSEKEKSAQL 117 >SB_47491| Best HMM Match : Acyl-CoA_dh_N (HMM E-Value=0.36) Length = 431 Score = 28.7 bits (61), Expect = 2.4 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +1 Query: 193 LSKKEAKLREIEAKEKVIRDAKLKEE-KERASALEIKALEEM 315 L+ +E + R I+ +E + AKLKEE +ER +K LE++ Sbjct: 106 LTPEELEQRRIKRQEAAAKRAKLKEEAEERREQERMKKLEKL 147 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 28.7 bits (61), Expect = 2.4 Identities = 14/58 (24%), Positives = 35/58 (60%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDKIVI 357 + + ++A+L+E++ KEK+ ++ + K+++ER E K ++ K+ + K++I Sbjct: 888 KEKKDNEKARLKEMKDKEKIEKEKREKDKREREEK-ERKRRQQQLEKEKKEKEKKLLI 944 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKER 279 K++ +LRE E KEK + K+EKER Sbjct: 953 KQKERLREKEEKEKQKEAERAKKEKER 979 >SB_21494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 28.3 bits (60), Expect = 3.2 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = +1 Query: 142 WSFLTVGV--LYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEM 315 W+FL V + L G L+KK KLR E EK+ K +EE R + L + Sbjct: 96 WAFLRVLMVELTGFIDLQVLNKKYNKLRVTEFTEKLYNSFKSREEDMRNATKTALLLRKF 155 Query: 316 AS 321 A+ Sbjct: 156 AT 157 >SB_33744| Best HMM Match : SMC_N (HMM E-Value=0) Length = 1014 Score = 27.9 bits (59), Expect = 4.3 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 4/48 (8%) Frame = +1 Query: 184 QNRLSKKEAKLREIE---AKEKVIRDAKLKEEKERASALEI-KALEEM 315 Q + KK++KL+EIE A+E KLKE ERAS LE K + E+ Sbjct: 182 QRTIEKKDSKLQEIETILAEEITPTLKKLKE--ERASYLEYQKVMREL 227 >SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) Length = 265 Score = 27.9 bits (59), Expect = 4.3 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +1 Query: 187 NRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIK-ALEEMASGTAKK*KDK 348 N+ ++KE K RE E K D ++EK+R ALE K A +M K K K Sbjct: 46 NKSAEKERKEREEEDKLWEDDDKHEQQEKKRLEALERKNAARQMLEEEEKSLKGK 100 >SB_58681| Best HMM Match : MAP65_ASE1 (HMM E-Value=3.3e-26) Length = 631 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/42 (28%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +1 Query: 208 AKLREIEAKEKV---IRDAKLKEEKERASALEIKALEEMASG 324 ++L+E +K+ V + D +K+EK+R AL+++ +++ G Sbjct: 233 SELKEYNSKKNVTENVSDPTMKDEKQRLQALKLQHMQKFIEG 274 >SB_45217| Best HMM Match : Linker_histone (HMM E-Value=4.4e-27) Length = 228 Score = 27.9 bits (59), Expect = 4.3 Identities = 18/60 (30%), Positives = 32/60 (53%) Frame = +1 Query: 172 GAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDKI 351 G+F ++ +KKE ++ E +AK K R + + EKE A ++K ++ G K K+ Sbjct: 80 GSFKLSQDTKKEGEMAEKKAKAKE-RKLQKQLEKEAAEEEKVKKPKKSRDGEKTKKSKKV 138 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 Q + +K+ + E+ KEK + K+ +EK + +E + +E Sbjct: 1184 QKKREEKKKREEEMREKEKEMEQNKIDQEKRKQELMESRRFQE 1226 >SB_45585| Best HMM Match : Swi3 (HMM E-Value=0.37) Length = 341 Score = 27.5 bits (58), Expect = 5.6 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +1 Query: 184 QNRLSKKEAKLR-EIEAKEKVIRDAKLKEEKERASALEIKALEE 312 QNR ++++K+ + EK+ RD+K KEE+ER + E L E Sbjct: 201 QNRTIEEKSKIAFDKWMSEKLKRDSKKKEEEERKAREEKDKLIE 244 >SB_6594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 27.5 bits (58), Expect = 5.6 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 187 NRLSKKEAKLREIEAKEKVIRDAKLKEEKER 279 NR+ K+EA E + K +R AK KE+K+R Sbjct: 162 NRVEKREALKTRFEIERK-LRQAKKKEKKKR 191 >SB_58221| Best HMM Match : TBC (HMM E-Value=2.9e-08) Length = 580 Score = 27.5 bits (58), Expect = 5.6 Identities = 19/64 (29%), Positives = 28/64 (43%) Frame = +1 Query: 115 ISPLIKFGRWSFLTVGVLYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALE 294 ISP ++ W FL YG ++R + AK E + + + K+EK A E Sbjct: 194 ISPSLRGDVWRFLLGYYKYGCTFESRKTLCRAKEDEYQTMKMQWQTISAKQEKRFAEFRE 253 Query: 295 IKAL 306 K L Sbjct: 254 RKQL 257 >SB_36059| Best HMM Match : TolA (HMM E-Value=0.1) Length = 1936 Score = 27.5 bits (58), Expect = 5.6 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +1 Query: 193 LSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK 336 + +K + ++ K ++ R K ++EKE + LE K LEE + K+ Sbjct: 1201 VDRKHLEQKKQRLKREMERQEKERKEKEMQALLEEKRLEEEKNAKRKR 1248 >SB_35264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 619 Score = 27.5 bits (58), Expect = 5.6 Identities = 17/62 (27%), Positives = 31/62 (50%) Frame = +1 Query: 151 LTVGVLYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTA 330 + V + G + + K ++L+ I V+R A K KE++S L+ E AS T+ Sbjct: 313 MVVDEITGTQNTASSAAKLSRLKTIVNYSSVVRSAPAKGGKEKSSLLDSLRSESFASPTS 372 Query: 331 KK 336 ++ Sbjct: 373 EE 374 >SB_19757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 354 YKLIVKSADIFFHISIKIANSVVINLFNENIGEK 455 +K IV SA +FF + ++++ N+F + GE+ Sbjct: 61 WKCIVISASLFFLVGLEVSELTGTNIFMDQKGER 94 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 354 YKLIVKSADIFFHISIKIANSVVINLFNENIGEK 455 +K IV SA +FF + ++++ N+F + GE+ Sbjct: 191 WKCIVISASLFFLVGLEVSELTGTNIFMDQKGER 224 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 27.5 bits (58), Expect = 5.6 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -3 Query: 170 YRTPT--VRKDQRPNLIRGDIRTGAPYGKSDILL*NCCTVKQ 51 Y TP VR+DQR ++I + + + ++LL N CT Q Sbjct: 696 YTTPACLVREDQRRSIITQQLHAWSEKIREEVLLHNTCTPGQ 737 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -3 Query: 170 YRTPT--VRKDQRPNLIRGDIRTGAPYGKSDILL*NCCTVKQ 51 Y TP VR+DQR ++I + + + ++LL N CT Q Sbjct: 516 YTTPARLVREDQRRSIITQHLHAWSEKIREEVLLHNTCTPGQ 557 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -3 Query: 170 YRTPT--VRKDQRPNLIRGDIRTGAPYGKSDILL*NCCTVKQ 51 Y TP VR+DQR ++I + + + ++LL N CT Q Sbjct: 596 YTTPARLVREDQRRSIITQHLHAWSEKIREEVLLHNTCTPGQ 637 >SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) Length = 591 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKER 279 KKE + + EA+EK +++ +++ EKER Sbjct: 346 KKEEEKKRKEAEEKRVKEEQIRLEKER 372 >SB_47152| Best HMM Match : Vicilin_N (HMM E-Value=5.4) Length = 330 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 147 LPHRRSSIRRLPPEQAIKERSETTRD*SQREGHPR 251 L +R R+LPPEQ K +++ R S ++ HP+ Sbjct: 209 LTPKRPKTRQLPPEQRCKS-TQSPRILSHQQSHPK 242 >SB_36416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 47 IIVLQYSNFITKCQIYHTEHLCVYRL*SSLDVG 145 ++++ Y ITKC + H E L V SSL +G Sbjct: 15 LVLVMYWYMITKCLVRHAEDLGVQPTKSSLLIG 47 >SB_810| Best HMM Match : TAF4 (HMM E-Value=4.7e-31) Length = 883 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = +1 Query: 190 RLSKKEAKLREIEAKEKVIRDAKLKEEKE 276 ++ + E K RE+ +E ++R AKL++E+E Sbjct: 682 QIDEVERKKRELREREVLMRAAKLQQEEE 710 >SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 26.6 bits (56), Expect = 9.9 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDA---KLKEEKERASALEIKALEEMASGTAK 333 +K+ K++ +E +EK +RD LKE KER LE + L + K Sbjct: 309 EKQKKIK-LEQQEKELRDKLLKNLKEMKERKQELERELLRKQIKNKVK 355 >SB_8891| Best HMM Match : Zot (HMM E-Value=2.5) Length = 392 Score = 26.6 bits (56), Expect = 9.9 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +1 Query: 196 SKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK 336 +KK + L E+E + RD + K+R SA E++ E+ GTA++ Sbjct: 270 TKKFSNLGEVEKDGRQGRDVTHDDVKQRMSAEEVRKYEK-RYGTARQ 315 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = +1 Query: 181 HQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEM 315 HQ+ + +L E E +E+ R + +EE++R +A E L+E+ Sbjct: 556 HQDVEDDETKRLEEEERQEEEQRRQQEEEERQRIAAEEAARLQEL 600 >SB_43667| Best HMM Match : EHN (HMM E-Value=4.3) Length = 114 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 181 HQNRLSKKEAKLREIEAKEK 240 HQ RLSK+E KL+ + K K Sbjct: 62 HQKRLSKREKKLKRLAKKGK 81 >SB_22025| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.12) Length = 495 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +1 Query: 196 SKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEM 315 SK R+++AK +R A+LK+ KE+ + KA+EE+ Sbjct: 194 SKLTQTCRDLKAKLDTLR-AELKKLKEKRKTPDDKAMEEL 232 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,656,728 Number of Sequences: 59808 Number of extensions: 217212 Number of successful extensions: 769 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 692 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 760 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 932979724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -