BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10c13 (460 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g65540.1 68414.m07435 calcium-binding EF hand family protein ... 34 0.040 At1g10890.1 68414.m01251 F-box family protein contains Pfam PF00... 33 0.070 At3g05110.1 68416.m00555 hypothetical protein 32 0.16 At1g72410.1 68414.m08374 COP1-interacting protein-related simila... 31 0.37 At1g04600.1 68414.m00454 myosin, putative similar to myosin (GI:... 30 0.86 At2g22795.1 68415.m02704 expressed protein 29 2.0 At2g04495.1 68415.m00454 expressed protein 29 2.0 At5g13340.1 68418.m01535 expressed protein 28 2.6 At4g27980.1 68417.m04014 expressed protein 28 2.6 At3g51910.1 68416.m05694 heat shock transcription factor family ... 28 2.6 At3g16620.1 68416.m02124 chloroplast outer membrane protein, put... 28 2.6 At5g37475.1 68418.m04510 translation initiation factor-related s... 28 3.5 At4g05110.1 68417.m00759 equilibrative nucleoside transporter, p... 28 3.5 At3g62940.2 68416.m07071 OTU-like cysteine protease family prote... 28 3.5 At3g62940.1 68416.m07070 OTU-like cysteine protease family prote... 28 3.5 At5g67240.1 68418.m08475 exonuclease family protein contains exo... 27 4.6 At4g36520.1 68417.m05185 trichohyalin-related low similarity to ... 27 4.6 At2g16640.1 68415.m01910 chloroplast outer membrane protein, put... 27 4.6 At5g53400.1 68418.m06635 nuclear movement family protein contain... 27 6.1 At4g26630.1 68417.m03837 expressed protein 27 6.1 At1g13220.2 68414.m01534 nuclear matrix constituent protein-rela... 27 6.1 At1g13220.1 68414.m01533 nuclear matrix constituent protein-rela... 27 6.1 At1g05320.1 68414.m00539 myosin-related similar to non-muscle my... 27 6.1 At5g55860.1 68418.m06963 expressed protein contains Pfam profile... 27 8.1 At5g45510.1 68418.m05590 leucine-rich repeat family protein cont... 27 8.1 At3g31320.1 68416.m03987 hypothetical protein 27 8.1 At3g20260.1 68416.m02566 expressed protein 27 8.1 At2g21800.1 68415.m02591 expressed protein 27 8.1 At1g66960.1 68414.m07614 lupeol synthase, putative / 2,3-oxidosq... 27 8.1 >At1g65540.1 68414.m07435 calcium-binding EF hand family protein similar to leucine zipper-EF-hand containing transmembrane protein 1 [Homo sapiens] GI:4235226; contains Pfam profile PF00036: EF hand Length = 736 Score = 34.3 bits (75), Expect = 0.040 Identities = 23/66 (34%), Positives = 41/66 (62%), Gaps = 6/66 (9%) Frame = +1 Query: 154 TVGVLYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEE------KERASALEIKALEEM 315 TVGV ++ +S+++ KL +E +E++I++ + +EE KE AS+ + AL+EM Sbjct: 479 TVGVT-ALSSEDSVSERKRKLEYLEMQEELIKEEEEEEEEEMAKMKESASSQKDVALDEM 537 Query: 316 ASGTAK 333 + TAK Sbjct: 538 MASTAK 543 >At1g10890.1 68414.m01251 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 592 Score = 33.5 bits (73), Expect = 0.070 Identities = 19/38 (50%), Positives = 26/38 (68%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 +KEA L IEAKEK R+ + KEE+ER + +K +EE Sbjct: 133 EKEASL--IEAKEKEEREQQEKEERERIAEENLKRVEE 168 >At3g05110.1 68416.m00555 hypothetical protein Length = 372 Score = 32.3 bits (70), Expect = 0.16 Identities = 17/37 (45%), Positives = 24/37 (64%) Frame = +1 Query: 190 RLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIK 300 +L +E +LRE+EAK K D K KE +E+ LE+K Sbjct: 68 QLEARENELREVEAKRKFF-DLKEKELEEKEKELELK 103 >At1g72410.1 68414.m08374 COP1-interacting protein-related similar to COP1-Interacting ProteinI 7 (CIP7) [Arabidopsis thaliana] GI:3327870 Length = 1163 Score = 31.1 bits (67), Expect = 0.37 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Frame = +1 Query: 172 GAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKE--RASALEIKALEEMASGTAK 333 G F++ + K++AKLRE + +K ++ KLK +E S E+KA +S K Sbjct: 659 GKFYEKYMKKRDAKLREEWSLKKGEKETKLKSMQEALEQSRTEMKAKLSASSSERK 714 >At1g04600.1 68414.m00454 myosin, putative similar to myosin (GI:499047) [Arabidopsis thaliana] Length = 1730 Score = 29.9 bits (64), Expect = 0.86 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLK-EEKERASALEIKALEEM 315 Q R+ +EAK +EIEA + V+ D KL+ + + + EI L+ + Sbjct: 909 QMRMEIEEAKSQEIEALQSVLTDIKLQLRDTQETKSKEISDLQSV 953 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 28.7 bits (61), Expect = 2.0 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 196 SKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 S++E +E EAKEKV ++ K E + +E LEE Sbjct: 462 SQEETMDKETEAKEKVESSSQEKNEDKETEKIESSFLEE 500 >At2g04495.1 68415.m00454 expressed protein Length = 202 Score = 28.7 bits (61), Expect = 2.0 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +1 Query: 157 VGVLYGAFHQNRLSKKEAKLREI--EAKEKVIRDAKLKEEKERASALEIKALEE 312 VG + G+FH N S + K I + KE I+D K + K+ + LE K++ + Sbjct: 66 VGFILGSFHGNSESLSQGKAINIIEQTKEVGIKDLKETKLKKVVALLEEKSVSK 119 >At5g13340.1 68418.m01535 expressed protein Length = 242 Score = 28.3 bits (60), Expect = 2.6 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASAL-EIKALEEMA 318 K+E + R EA EK+ D +++ +KE+ +AL E + EE A Sbjct: 118 KEEIERRTKEAYEKMFLDVEIQLKKEKEAALNEARRKEEQA 158 >At4g27980.1 68417.m04014 expressed protein Length = 565 Score = 28.3 bits (60), Expect = 2.6 Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +1 Query: 193 LSKKEAKLREIEAKEKVIRDAKLKEE-KERASALEIKALE 309 L KKE +LR +E KEK I L+E R S LE K +E Sbjct: 48 LEKKEERLRVVEMKEKEI--GLLEESISRRLSVLEEKEIE 85 Score = 26.6 bits (56), Expect = 8.1 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = +1 Query: 178 FHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDKI 351 FH + ++ E + E EA+EK D + EE + E+K EE K+ +K+ Sbjct: 161 FHLKQRAETERRNEESEAREK---DLRALEEAVKEKTAELKRKEETLELKMKEEAEKL 215 >At3g51910.1 68416.m05694 heat shock transcription factor family protein contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 272 Score = 28.3 bits (60), Expect = 2.6 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = +1 Query: 145 SFLTVGVLYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASG 324 SFL + +F L +++ K++E+E E AK K S LE+ ALE G Sbjct: 180 SFLARAMQSPSFLHQLLKQRDKKIKELEDNE----SAKRKRGSSSMSELEVLALEMQGHG 235 >At3g16620.1 68416.m02124 chloroplast outer membrane protein, putative similar to chloroplast protein import component Toc159 [Pisum sativum] GI:8489806, chloroplast outer envelope protein 86 [Pisum sativum] GI:599958, GTP-binding protein [Pisum sativum] GI:576509 Length = 1089 Score = 28.3 bits (60), Expect = 2.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 196 SKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALE 309 S+K+ L E+E +EK+ ++KEE++R L+ A E Sbjct: 755 SQKKEYLDEMEYREKLFMKRQMKEERKRRKLLKKFAAE 792 >At5g37475.1 68418.m04510 translation initiation factor-related similar to Eukaryotic translation initiation factor 3 subunit 1 (eIF-3 alpha) (eIF3 p35) (eIF3j) (Swiss-Prot:O75822) [Homo sapiens] Length = 225 Score = 27.9 bits (59), Expect = 3.5 Identities = 16/54 (29%), Positives = 29/54 (53%) Frame = +1 Query: 124 LIKFGRWSFLTVGVLYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERAS 285 L+ F + SF +G+L + + K A ++++ + I + KLK EKE A+ Sbjct: 139 LVPFEK-SFHYIGLLKAVMRLSVANMKAADVKDVASSITAIANEKLKAEKEAAA 191 >At4g05110.1 68417.m00759 equilibrative nucleoside transporter, putative (ENT6) identical to putative equilibrative nucleoside transporter ENT6 [Arabidopsis thaliana] GI:16518997; contains similarity to SWISS-PROT:O54699 equilibrative nucleoside transporter 2 (Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleoside transporter, Equilibrative NBMPR-insensitive nucleoside transporter, Nucleoside transporter, ei-type) [Rattus norvegicus]; contains Pfam profile PF01733: Nucleoside transporter Length = 418 Score = 27.9 bits (59), Expect = 3.5 Identities = 17/66 (25%), Positives = 36/66 (54%) Frame = +1 Query: 19 IGFFQKVSYNNCFTVQQFYNKMSDLPYGAPVRISPLIKFGRWSFLTVGVLYGAFHQNRLS 198 +GF +S+N+ T +Y K+ P P R+ L+ + ++F + +L A+H+++ S Sbjct: 26 LGFGSLISWNSMLTTADYYYKV--FPDYHPSRVLTLV-YQPFAFGAIVIL--AYHESKTS 80 Query: 199 KKEAKL 216 ++ L Sbjct: 81 TRKRNL 86 >At3g62940.2 68416.m07071 OTU-like cysteine protease family protein contains Pfam profile PF02338: OTU-like cysteine protease Length = 332 Score = 27.9 bits (59), Expect = 3.5 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +1 Query: 160 GVLYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASA 288 GV A ++ K K RE AKE+ R+ ++KEE+ + Sbjct: 121 GVSVTAQQEHSKPSKSVKRREKRAKEEADREQRIKEEQSHVKS 163 >At3g62940.1 68416.m07070 OTU-like cysteine protease family protein contains Pfam profile PF02338: OTU-like cysteine protease Length = 316 Score = 27.9 bits (59), Expect = 3.5 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +1 Query: 160 GVLYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASA 288 GV A ++ K K RE AKE+ R+ ++KEE+ + Sbjct: 105 GVSVTAQQEHSKPSKSVKRREKRAKEEADREQRIKEEQSHVKS 147 >At5g67240.1 68418.m08475 exonuclease family protein contains exonuclease domain, Pfam:PF00929 Length = 745 Score = 27.5 bits (58), Expect = 4.6 Identities = 11/30 (36%), Positives = 22/30 (73%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASA 288 K AK +I+A++K+I + K+K EK+++ + Sbjct: 714 KLNAKEHQIQAQDKIIANLKMKLEKKQSKS 743 >At4g36520.1 68417.m05185 trichohyalin-related low similarity to SP|Q07283 Trichohyalin {Homo sapiens} Length = 1400 Score = 27.5 bits (58), Expect = 4.6 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKE 276 K E + R +EA+EK ++ K+KE++E Sbjct: 683 KAENERRAVEAREKAEQERKMKEQQE 708 >At2g16640.1 68415.m01910 chloroplast outer membrane protein, putative similar to chloroplast protein import component Toc159 [Pisum sativum] GI:8489806, chloroplast outer envelope protein 86 [Pisum sativum] GI:599958, GTP-binding protein [Pisum sativum] GI:576509 Length = 1206 Score = 27.5 bits (58), Expect = 4.6 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +1 Query: 196 SKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALE 309 S+K+ L E+E +EK++ ++KEE++R + A E Sbjct: 873 SQKKQYLDEMEYREKLLMKKQMKEERKRRKMFKKFAAE 910 >At5g53400.1 68418.m06635 nuclear movement family protein contains Pfam profile: PF03593 nuclear movement protein Length = 304 Score = 27.1 bits (57), Expect = 6.1 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 229 AKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK 336 AKEK+ + K K EKE +E KA +E+ KK Sbjct: 64 AKEKLKKAEKKKAEKESVKPVEKKAEKEIVKLVEKK 99 >At4g26630.1 68417.m03837 expressed protein Length = 763 Score = 27.1 bits (57), Expect = 6.1 Identities = 10/26 (38%), Positives = 20/26 (76%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKE 276 K+E K +E+EA + + ++K+++EKE Sbjct: 220 KEENKTKEVEAAKAEVDESKVEDEKE 245 >At1g13220.2 68414.m01534 nuclear matrix constituent protein-related similar to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1128 Score = 27.1 bits (57), Expect = 6.1 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +1 Query: 196 SKKEAKLREIEAKEKVIRDAKLKEEKERAS 285 S+ + +L+E+E +E V++ +L KER S Sbjct: 224 SELKLRLKEVETRESVLQQERLSFTKERES 253 >At1g13220.1 68414.m01533 nuclear matrix constituent protein-related similar to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 391 Score = 27.1 bits (57), Expect = 6.1 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +1 Query: 196 SKKEAKLREIEAKEKVIRDAKLKEEKERAS 285 S+ + +L+E+E +E V++ +L KER S Sbjct: 237 SELKLRLKEVETRESVLQQERLSFTKERES 266 >At1g05320.1 68414.m00539 myosin-related similar to non-muscle myosin II heavy chain (GI:19879404) [Loligo pealei]; ESTs gb|AA042402,gb|ATTS1380 come from this gene Length = 828 Score = 27.1 bits (57), Expect = 6.1 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +1 Query: 265 EEKERASALEIKALEEMASGTAKK*KDKIVIS 360 E++ R SALE + LEE+ +A + ++K+ IS Sbjct: 103 EDRIRISALEAEKLEELQKQSASELEEKLKIS 134 >At5g55860.1 68418.m06963 expressed protein contains Pfam profile PF05701: Plant protein of unknown function (DUF827); expression supported by MPSS Length = 649 Score = 26.6 bits (56), Expect = 8.1 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Frame = +1 Query: 196 SKKEAKLREIEAKEKVIRDAKLK-----EEKERASALEIKALEEMASGTAK 333 +K + ++E E+ + D++L +E E A A E KALE++ S + K Sbjct: 411 NKAKELMKEAESAHLALEDSELHLRVALDEAEEAKAAETKALEQIKSMSEK 461 >At5g45510.1 68418.m05590 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 1222 Score = 26.6 bits (56), Expect = 8.1 Identities = 14/42 (33%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +1 Query: 223 IEAKEKVIRDAKL-KEEKERASALEIKALEEMASGTAKK*KD 345 +E KE V++ + K++KE+ +A +++A +++ AKK KD Sbjct: 150 LEKKEAVVKKLEDDKKKKEKEAAEKLEAEKKLVDPAAKKAKD 191 >At3g31320.1 68416.m03987 hypothetical protein Length = 327 Score = 26.6 bits (56), Expect = 8.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 181 HQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASA 288 H + + LRE+ AK+K ++ L EEK A A Sbjct: 241 HFVEMQSTKVTLREVSAKKKEDKERHLAEEKRLAEA 276 >At3g20260.1 68416.m02566 expressed protein Length = 437 Score = 26.6 bits (56), Expect = 8.1 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +3 Query: 123 SNQVWTLVLPHRRSSIRRLPPEQAIKERSETTRD*SQREGHPRCQAE 263 +N+V + RR+S L PE+ +E E+ D +G +C +E Sbjct: 59 TNEVKRRLKELRRNSFMVLIPEEEEEEEEESYLDEDDDDGEDKCSSE 105 >At2g21800.1 68415.m02591 expressed protein Length = 475 Score = 26.6 bits (56), Expect = 8.1 Identities = 13/45 (28%), Positives = 27/45 (60%) Frame = +1 Query: 175 AFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALE 309 A + +L K++ KL++ +K + KL+ EK++ + + KAL+ Sbjct: 199 AAEEKKLQKEQEKLQKAASKAEDAEHKKLEREKQKWAKEKDKALK 243 >At1g66960.1 68414.m07614 lupeol synthase, putative / 2,3-oxidosqualene-triterpenoid cyclase, putative similar to lupeol synthase GI:1762150 from [Arabidopsis thaliana], 2,3-oxidosqualene-triterpenoid cyclase [Arabidopsis thaliana] GI:2738027 Length = 763 Score = 26.6 bits (56), Expect = 8.1 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = +1 Query: 91 LPYGAPVRISPLIKFGRWSFLTVGVLYGAFHQNRLSKKEAKLRE 222 LPY P+ + + R +++ + LYG +++ +LRE Sbjct: 246 LPYFLPIHLGKAFSYTRITYMPISYLYGKKFVGQITPLIMQLRE 289 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,000,801 Number of Sequences: 28952 Number of extensions: 156487 Number of successful extensions: 613 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 762235320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -