BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10c07 (554 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U61151-1|AAB41306.1| 45|Tribolium castaneum TATH1 protein. 24 0.77 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 22 3.1 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 21 7.2 >U61151-1|AAB41306.1| 45|Tribolium castaneum TATH1 protein. Length = 45 Score = 24.2 bits (50), Expect = 0.77 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = +2 Query: 146 EQWRSQPLDTSMDRIRSLVPAVGS 217 E+ R L+ + DR+R +VP++G+ Sbjct: 6 ERRRMNSLNDAFDRLRDVVPSLGN 29 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/36 (25%), Positives = 14/36 (38%) Frame = +3 Query: 231 GSTCLDCTTKQVCTKVGGIQRACLDPTLPYCNLGEC 338 G TC+D +CT G + + C+ C Sbjct: 35 GGTCIDGINSYICTCKPGFTGSNCQNRINLCDSSPC 70 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 21.0 bits (42), Expect = 7.2 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -1 Query: 200 PGSGCDPWRYP 168 P S CDPW P Sbjct: 30 PPSYCDPWYNP 40 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,909 Number of Sequences: 336 Number of extensions: 2503 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13725787 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -