BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10c04 (316 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.11 |cox2||cytochrome c oxidase 2|Schizosaccharomyces pombe... 83 1e-17 SPAC959.04c |||mannosyltransferase |Schizosaccharomyces pombe|ch... 23 8.3 >SPMIT.11 |cox2||cytochrome c oxidase 2|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 248 Score = 83.0 bits (196), Expect = 1e-17 Identities = 38/86 (44%), Positives = 52/86 (60%) Frame = +3 Query: 3 EIKNNEFRLLDVDXXXXXXXXXXXXXXXTATDVIHS*TIPSLGIKVDANPGRLNQTNFFI 182 +++ R L+VD T+ DVIHS +PSLGIK D P RLNQ + I Sbjct: 148 DLEEGSLRQLEVDNRLVLPIDTRIRLILTSGDVIHSWAVPSLGIKCDCIPSRLNQVSLSI 207 Query: 183 NRPGIFFGQCSEICGANHSFIPIVIE 260 +R G+F+GQCSE+CG HS +PIV++ Sbjct: 208 DREGLFYGQCSELCGVLHSSMPIVVQ 233 >SPAC959.04c |||mannosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 298 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 212 FRNLWS*S*FYTYCN*KYFNQKL 280 F N+W S YTYC FN+ L Sbjct: 200 FSNIWVYSNNYTYCKYWPFNEIL 222 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,110,146 Number of Sequences: 5004 Number of extensions: 19111 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 83936266 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -