BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10c04 (316 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58485| Best HMM Match : COX2 (HMM E-Value=0) 112 7e-26 SB_14168| Best HMM Match : COX2 (HMM E-Value=0) 112 7e-26 SB_12233| Best HMM Match : COX2 (HMM E-Value=0) 61 2e-10 SB_59548| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.8 >SB_58485| Best HMM Match : COX2 (HMM E-Value=0) Length = 239 Score = 112 bits (269), Expect = 7e-26 Identities = 50/86 (58%), Positives = 61/86 (70%) Frame = +3 Query: 3 EIKNNEFRLLDVDXXXXXXXXXXXXXXXTATDVIHS*TIPSLGIKVDANPGRLNQTNFFI 182 ++ +FRLL+VD TA DVIHS +P+L +K+DA PGRLNQT FFI Sbjct: 137 DLNQGDFRLLEVDNRLVVPINTHVRVLITAADVIHSFAVPALAVKMDAVPGRLNQTGFFI 196 Query: 183 NRPGIFFGQCSEICGANHSFIPIVIE 260 RPG+F+GQCSEICGANHSF+PIVIE Sbjct: 197 KRPGVFYGQCSEICGANHSFMPIVIE 222 >SB_14168| Best HMM Match : COX2 (HMM E-Value=0) Length = 239 Score = 112 bits (269), Expect = 7e-26 Identities = 50/86 (58%), Positives = 61/86 (70%) Frame = +3 Query: 3 EIKNNEFRLLDVDXXXXXXXXXXXXXXXTATDVIHS*TIPSLGIKVDANPGRLNQTNFFI 182 ++ +FRLL+VD TA DVIHS +P+L +K+DA PGRLNQT FFI Sbjct: 137 DLNQGDFRLLEVDNRLVVPINTHVRVLITAADVIHSFAVPALAVKMDAVPGRLNQTGFFI 196 Query: 183 NRPGIFFGQCSEICGANHSFIPIVIE 260 RPG+F+GQCSEICGANHSF+PIVIE Sbjct: 197 KRPGVFYGQCSEICGANHSFMPIVIE 222 >SB_12233| Best HMM Match : COX2 (HMM E-Value=0) Length = 219 Score = 60.9 bits (141), Expect = 2e-10 Identities = 29/66 (43%), Positives = 38/66 (57%) Frame = +3 Query: 3 EIKNNEFRLLDVDXXXXXXXXXXXXXXXTATDVIHS*TIPSLGIKVDANPGRLNQTNFFI 182 ++ +FRLL+VD TA DVIHS +P+L +K+DA PGRLNQT FFI Sbjct: 137 DLNQGDFRLLEVDNRLVVPINTHVRVLITAADVIHSFAVPALAVKMDAVPGRLNQTGFFI 196 Query: 183 NRPGIF 200 + F Sbjct: 197 KKTWSF 202 >SB_59548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2835 Score = 25.4 bits (53), Expect = 9.8 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -3 Query: 293 NSINKVFD*NTFNYNRYKTMISSTNF*TLTKKNSRSI 183 N ++ D + FN++ YK + S TN T S ++ Sbjct: 2715 NRERQIIDDDNFNFDNYKIITSGTNCVEYTAMRSHAL 2751 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,301,515 Number of Sequences: 59808 Number of extensions: 114855 Number of successful extensions: 132 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 400488992 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -