BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10c01 (452 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15840.1 68417.m02409 expressed protein 29 1.1 At2g21300.1 68415.m02535 kinesin motor family protein contains P... 27 4.5 At5g07790.1 68418.m00892 expressed protein 27 5.9 At4g16141.1 68417.m02446 expressed protein contains 1 predicted ... 27 5.9 At4g03610.1 68417.m00496 phosphonate metabolism protein-related ... 27 5.9 >At4g15840.1 68417.m02409 expressed protein Length = 660 Score = 29.5 bits (63), Expect = 1.1 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 185 ISGSRARFQLSGNSGRKHSRCCTSILRKFSG 277 +SGS FQ S NS R CTS++ K G Sbjct: 115 VSGSNLVFQQSSNSQTNFGRPCTSVVDKTEG 145 >At2g21300.1 68415.m02535 kinesin motor family protein contains Pfam profile: kinesin motor domain PF00225 Length = 862 Score = 27.5 bits (58), Expect = 4.5 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 95 KLKEHGASSCISGKRGRRCCNIWHWGSVDSISG 193 K+ EH ASS R N W GSV ISG Sbjct: 425 KMVEHDASSKAGTPHFRNRTNKWEDGSVSEISG 457 >At5g07790.1 68418.m00892 expressed protein Length = 616 Score = 27.1 bits (57), Expect = 5.9 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 116 SSCISGKRGRRCCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSI 259 S + KR RR + G+ +S + A +S SGR+ + C TS+ Sbjct: 411 SGRVKRKRSRRISLVAE-GNYQQVSAAEAIVDISRKSGRETAACITSL 457 >At4g16141.1 68417.m02446 expressed protein contains 1 predicted transmembrane domain; contains a partial Pfam PF00320: GATA zinc finger profile Length = 226 Score = 27.1 bits (57), Expect = 5.9 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -2 Query: 391 KTEKVRSWSDVENG*CLASPHGVGATMAAAVNCDT 287 K E SDV+NG C +S G G T V+C T Sbjct: 11 KLESAGDSSDVDNGNCSSSGSG-GDTKKTCVDCGT 44 >At4g03610.1 68417.m00496 phosphonate metabolism protein-related weak similarity to PhnP protein. (Swiss-Prot:P16692) [Escherichia coli] Length = 290 Score = 27.1 bits (57), Expect = 5.9 Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = -3 Query: 189 LMESTDPQCHILQHRRPRLPLMQLEAPCS----FNFCSLRAIRRYKSYYVD*G 43 L++ +DP CH+ LP + C+ ++CS R+K +D G Sbjct: 30 LLQPSDPPCHVCSQSLSLLPHLNPNYRCNTSLLIDYCSKEEDGRHKYILIDVG 82 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,116,507 Number of Sequences: 28952 Number of extensions: 169122 Number of successful extensions: 376 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 373 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 376 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 742437000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -