BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10b24 (675 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45279| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_24417| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_903| Best HMM Match : DUF1328 (HMM E-Value=2.4) 29 3.4 SB_57854| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 >SB_45279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 29.5 bits (63), Expect = 2.6 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +2 Query: 182 NNDIDNACRLINRIMGKEGLLAQYRLTRY-YEKPFQTRRRVNHEKCKAIYNEDMERKIQF 358 N+D+D A I+ KEG+ AQ+ ++ EK + R+ + K + ++D + F Sbjct: 105 NDDLDKAYTEFKDIISKEGISAQFGKSQMATEKSVEKRKPTREGEYKKVTSQDYPSML-F 163 Query: 359 VLRK 370 LR+ Sbjct: 164 ALRR 167 >SB_24417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 29.5 bits (63), Expect = 2.6 Identities = 18/71 (25%), Positives = 35/71 (49%) Frame = +2 Query: 173 FVQNNDIDNACRLINRIMGKEGLLAQYRLTRYYEKPFQTRRRVNHEKCKAIYNEDMERKI 352 FV+ D + +C+ I+ +E L + Y+ KP + R E + + E++E+K Sbjct: 117 FVEALDFEFSCKEIDVGFLREMLPQDVIIMSYFIKPARVMHRPPDEARE--FWEELEKKA 174 Query: 353 QFVLRKNRHEP 385 ++ N H+P Sbjct: 175 NLIMVVNEHDP 185 >SB_903| Best HMM Match : DUF1328 (HMM E-Value=2.4) Length = 350 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -1 Query: 225 IILLINLHALSISLFCTNTVRAMKEGCLFDNRRS 124 I+ + N+ A+ + L C R+ + GCLF N RS Sbjct: 152 ILEMYNIQAVLLLLSCLFGGRSSERGCLFQNSRS 185 >SB_57854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -2 Query: 467 RSIPIIHMMSGYNLLFTFDLSFSNILERVHVYFFLIQIVFFSPYLHCR 324 R +P++ M++ L F +D ILE H F +Q+ ++ +H + Sbjct: 475 RPVPVLSMVTNQVLDFIYDTHGHRILEWSHDLFGSVQLQTYADVVHAK 522 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,555,109 Number of Sequences: 59808 Number of extensions: 376855 Number of successful extensions: 797 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 795 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -