BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10b23 (653 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19850.1 68417.m02909 lectin-related low similarity to PP2 le... 28 6.2 At2g23950.1 68415.m02860 leucine-rich repeat family protein / pr... 27 8.2 >At4g19850.1 68417.m02909 lectin-related low similarity to PP2 lectin polypeptide [Cucurbita maxima] GI:410437 Length = 194 Score = 27.9 bits (59), Expect = 6.2 Identities = 16/60 (26%), Positives = 32/60 (53%), Gaps = 6/60 (10%) Frame = +2 Query: 44 LRLRKRNSLTICSRDVAALPYIPTRAVNFIDGSIF------YIFILCNFLVIVDFCFYYI 205 +R+++R +++ C+R+++ L + +N GS+ Y F C + V FCF+ I Sbjct: 1 MRVKRRKTVSCCTREISQLHGQSLKQINIGVGSLILTKHQGYEF-YCKKVTFVFFCFFKI 59 >At2g23950.1 68415.m02860 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 634 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +1 Query: 526 LLICAAMCCWLQSPARQPQNERASTDTHQIDDPXHVISMPDE 651 LL+C + C L S R P+ E +++ DP V DE Sbjct: 16 LLLCFFVTCSLSSEPRNPEVEALINIKNELHDPHGVFKNWDE 57 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,823,547 Number of Sequences: 28952 Number of extensions: 254756 Number of successful extensions: 580 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 580 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -