BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10b14 (576 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC23E6.09 |ssn6||transcriptional corepressor Ssn6|Schizosaccha... 27 2.6 SPAC3G9.09c |tif211||translation initiation factor eIF2 alpha su... 26 3.4 SPCC11E10.04 |||mitochondrial ATPase expression protein homolog|... 25 7.9 SPAPB1A11.04c |||transcription factor |Schizosaccharomyces pombe... 25 7.9 SPAC167.03c |snu66||U4/U6 x U5 tri-snRNP complex subunit Snu66 |... 25 7.9 >SPBC23E6.09 |ssn6||transcriptional corepressor Ssn6|Schizosaccharomyces pombe|chr 2|||Manual Length = 1102 Score = 26.6 bits (56), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +1 Query: 400 NPVLSHG-GLLLDRYGEPPRLREAILRC 480 +P L +G G+L DRYG EA ++C Sbjct: 437 DPKLWYGIGILYDRYGSHEHAEEAFMQC 464 >SPAC3G9.09c |tif211||translation initiation factor eIF2 alpha subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 306 Score = 26.2 bits (55), Expect = 3.4 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 23 GWPPYRCAVHYLVQFKVTYANRTYLFE 103 GWP YR H FK+ +N ++FE Sbjct: 131 GWPLYRKYGHAYDAFKLAISNPDHVFE 157 >SPCC11E10.04 |||mitochondrial ATPase expression protein homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 443 Score = 25.0 bits (52), Expect = 7.9 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 75 HTRIGLIYLNFLRIISRLLRQCV*RLDLYN 164 H RI I L F+R+ S++ R CV +++Y+ Sbjct: 327 HARIKNIEL-FIRLYSQMYRHCVPIIEIYD 355 >SPAPB1A11.04c |||transcription factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 697 Score = 25.0 bits (52), Expect = 7.9 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = -3 Query: 244 NSPHLNFSYNHRFFDDTQKNMR 179 +SP+++F+Y+ F D QK +R Sbjct: 95 SSPNMDFTYSINSFGDYQKQLR 116 >SPAC167.03c |snu66||U4/U6 x U5 tri-snRNP complex subunit Snu66 |Schizosaccharomyces pombe|chr 1|||Manual Length = 649 Score = 25.0 bits (52), Expect = 7.9 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +2 Query: 305 VSPVTIRDEWLTMEQTCYNMMRKQIQEEV 391 +S +++ ++ EQ Y +KQ QEE+ Sbjct: 39 LSDASVKSSYVDQEQQAYENWKKQEQEEI 67 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,956,401 Number of Sequences: 5004 Number of extensions: 34787 Number of successful extensions: 89 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -