BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10b06 (674 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 22 4.7 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 21 8.1 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 8.1 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +2 Query: 431 IVINEDMASWIPAIHSYSALPWVFILP 511 +V+ +A W+P Y A P+V + P Sbjct: 310 VVVGGFVACWLPFFILYLATPFVPVEP 336 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 21.4 bits (43), Expect = 8.1 Identities = 9/28 (32%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +2 Query: 539 KSYILV-CIFACIGFLTHYCSKTIIHVI 619 K+++++ I C+G +TH KT I + Sbjct: 2 KTFVIIFAICVCVGAMTHEELKTGIQTL 29 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.4 bits (43), Expect = 8.1 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +2 Query: 314 LLRQLLISTGPWNCYFMFGLCVGSPTVMIPQIRKDINSTIVINED 448 LL+Q+ I P N +G P ++ Q +N+T+ I +D Sbjct: 168 LLKQIEI---PHNIAVNASTGMGGPVSLVVQAMDPMNTTVYIADD 209 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,201 Number of Sequences: 438 Number of extensions: 3933 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -