BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10b04 (396 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32430.1 68417.m04616 pentatricopeptide (PPR) repeat-containi... 30 0.64 At2g36730.1 68415.m04506 pentatricopeptide (PPR) repeat-containi... 29 1.1 At5g16860.1 68418.m01975 pentatricopeptide (PPR) repeat-containi... 28 2.6 At3g02850.1 68416.m00277 stelar K+ outward rectifier (SKOR) / po... 28 2.6 At4g30700.1 68417.m04351 pentatricopeptide (PPR) repeat-containi... 27 3.4 At3g26580.1 68416.m03318 expressed protein 27 4.5 At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) n... 27 4.5 At4g20290.1 68417.m02963 expressed protein 27 6.0 At2g37380.1 68415.m04584 expressed protein 27 6.0 At4g35880.1 68417.m05095 aspartyl protease family protein contai... 26 7.9 At4g31070.1 68417.m04411 pentatricopeptide (PPR) repeat-containi... 26 7.9 >At4g32430.1 68417.m04616 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 763 Score = 29.9 bits (64), Expect = 0.64 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 4/57 (7%) Frame = +3 Query: 120 GLLNAV-IKRNIIVALALSGVA---GFTFKQLIGNERKRKYAEFYRTYDAEKEFEEM 278 GL+NAV I L + G+ GF + +GN YA+F DA+K FE++ Sbjct: 377 GLINAVKCNEQIKEGLKIHGLCIKTGFVSEPSVGNSFITLYAKFEALEDAKKAFEDI 433 >At2g36730.1 68415.m04506 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 501 Score = 29.1 bits (62), Expect = 1.1 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 183 GFTFKQLIGNERKRKYAEFYRTYDAEKEFEEMRKKGL 293 GF F +GN Y +T DA K F+EM ++ + Sbjct: 143 GFDFDVYVGNNLIHLYGTCKKTSDARKVFDEMTERNV 179 >At5g16860.1 68418.m01975 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 850 Score = 27.9 bits (59), Expect = 2.6 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 159 ALALSGVAGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEM 278 A ALS V GF +GN Y+ DA K F+EM Sbjct: 149 AHALSLVTGFISNVFVGNALVAMYSRCRSLSDARKVFDEM 188 >At3g02850.1 68416.m00277 stelar K+ outward rectifier (SKOR) / potassium channel protein identical to SKOR [Arabidopsis thaliana] gi|3810676|emb|CAA11280; member of the 1 pore, 6 transmembrane (1P/6TM) Shaker K+ channel family, PMID:11500563 Length = 828 Score = 27.9 bits (59), Expect = 2.6 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 212 ITNELLEGKTSDARESQSNNNVTFDDGVEE 123 I N LLEGK S+ R Q +++TF +E Sbjct: 516 ILNNLLEGKESNVRIKQLESDITFHISKQE 545 >At4g30700.1 68417.m04351 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 792 Score = 27.5 bits (58), Expect = 3.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 177 VAGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEMRKK 287 V G + L+G+ + Y +F+R DA K F+ M +K Sbjct: 147 VDGCDSELLLGSNIVKMYFKFWRVEDARKVFDRMPEK 183 >At3g26580.1 68416.m03318 expressed protein Length = 350 Score = 27.1 bits (57), Expect = 4.5 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +3 Query: 204 IGNERKRKYAEFYRTYDAEKEFEEMRKK 287 + ERKR+ EF+ T + E++ EE++ K Sbjct: 113 VEKERKRRAKEFHDTKELERKAEELQYK 140 >At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) nearly identical to retinoblastoma-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma-associated protein A domain, PF01857 retinoblastoma-associated protein B domain Length = 1013 Score = 27.1 bits (57), Expect = 4.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +3 Query: 180 AGFTFKQLIGNERKRKYAEFYRTYDAEKE 266 A F L+ KR + EF+ TYDA E Sbjct: 149 ANFVHLSLLSKYYKRGFREFFLTYDANAE 177 >At4g20290.1 68417.m02963 expressed protein Length = 118 Score = 26.6 bits (56), Expect = 6.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 195 KQLIGNERKRKYAEFYRTYDAEKEFEEMRKKG 290 K+ G E+KR+ + D E+E EE R+KG Sbjct: 13 KERGGEEKKRRRSALNSEEDEEEEEEEGRRKG 44 >At2g37380.1 68415.m04584 expressed protein Length = 321 Score = 26.6 bits (56), Expect = 6.0 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 47 NFSKIIIRHGWRKCSIDSEQASDARS 124 +FS +I RH KCS S +S A S Sbjct: 228 SFSGVIQRHSQAKCSTSSSSSSSASS 253 >At4g35880.1 68417.m05095 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 524 Score = 26.2 bits (55), Expect = 7.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = -2 Query: 236 FSILSLALITNELLEGKTSDARESQSNNNVTFDDGVEETSHLRLARCRYCT 84 F + ++ + L+ G+ ES+S +++TF DG + L Y T Sbjct: 60 FEYFNALVLRDWLIRGRRLSESESESESSLTFSDGNSTSRISSLGFLHYTT 110 >At4g31070.1 68417.m04411 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 613 Score = 26.2 bits (55), Expect = 7.9 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +3 Query: 180 AGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEMRKKGLFQSC 305 AG ++ N YA+F R Y K F+EM + C Sbjct: 76 AGADCDTVVSNSLISMYAKFSRKYAVRKVFDEMLHRDTVSYC 117 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,912,965 Number of Sequences: 28952 Number of extensions: 114349 Number of successful extensions: 387 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 387 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 565902384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -