BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10b03 (676 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 8.8 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 23 8.8 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = +1 Query: 400 KKVRMARNILMSSLENASFNILIQILFRCITFI 498 +K A + + + FN+L+ ILF C++ + Sbjct: 301 EKSTSAGKVTGTPAQQDRFNVLLLILFLCVSIL 333 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.0 bits (47), Expect = 8.8 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -3 Query: 167 QIQGQHRPLSTPGSRFGLEFYPL*LQRFLQFSN 69 Q+Q Q L+ P GL +P ++FL +N Sbjct: 208 QLQRQQEELTCPPGVIGLRPHPTDCRKFLNCNN 240 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 630,025 Number of Sequences: 2352 Number of extensions: 11478 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -