BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10a21 (680 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4B3.02c |||Golgi transport protein Got1 |Schizosaccharomyces... 27 1.9 SPBC25D12.04 |suc22||ribonucleotide reductase small subunit Suc2... 25 7.7 >SPCC4B3.02c |||Golgi transport protein Got1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 129 Score = 27.5 bits (58), Expect = 1.9 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +2 Query: 563 LILSITHRLIIGFFLSILLYSSLC*VFYFMI 655 L+L++ H IIGFF+ L + +L VFY +I Sbjct: 74 LLLTLFHFPIIGFFVECLGFFNLFKVFYPLI 104 >SPBC25D12.04 |suc22||ribonucleotide reductase small subunit Suc22 |Schizosaccharomyces pombe|chr 2|||Manual Length = 391 Score = 25.4 bits (53), Expect = 7.7 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -1 Query: 263 ALYDRNKIELCIYYN*VAFRSIICAWSYKYYNTYIAYD 150 +L NK +C Y VA R ++ + KYYN +D Sbjct: 308 SLLGMNKDLMCQYIEFVADRLLVALGNDKYYNVTNPFD 345 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,672,949 Number of Sequences: 5004 Number of extensions: 54317 Number of successful extensions: 104 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -