BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10a21 (680 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 21 8.2 S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 21 8.2 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 21.4 bits (43), Expect = 8.2 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -2 Query: 211 LFVRSYVHGVTNTIIHT*RMTPQVPVCDHRNIS*FLTNM 95 L V YV G+ NT+ HT +P C I+ F +M Sbjct: 24 LVVGPYVIGLMNTMTHT-TNAFCLPFCGPNVINPFFCDM 61 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 21.4 bits (43), Expect = 8.2 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -2 Query: 211 LFVRSYVHGVTNTIIHT*RMTPQVPVCDHRNIS*FLTNM 95 L V YV G+ NT+ HT +P C I+ F +M Sbjct: 23 LVVGPYVIGLMNTMTHT-TNAFCLPFCGPNVINPFFCDM 60 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,813 Number of Sequences: 438 Number of extensions: 4394 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -