BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10a15 (239 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC030831-1|AAH30831.1| 369|Homo sapiens translocation associate... 28 4.6 AK074617-1|BAC11091.1| 369|Homo sapiens protein ( Homo sapiens ... 28 4.6 >BC030831-1|AAH30831.1| 369|Homo sapiens translocation associated membrane protein 1-like 1 protein. Length = 369 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 46 YAGLLWLATHYYFDSVFHKCAKYGLIYMKRNKY 144 + GLL L HY+ + + H C GL Y KY Sbjct: 217 HLGLLLLVLHYFVELLSHMC---GLFYFSDEKY 246 >AK074617-1|BAC11091.1| 369|Homo sapiens protein ( Homo sapiens cDNA FLJ90136 fis, clone HEMBB1000679, moderately similar to Translocation associated membrane protein 1. ). Length = 369 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 46 YAGLLWLATHYYFDSVFHKCAKYGLIYMKRNKY 144 + GLL L HY+ + + H C GL Y KY Sbjct: 217 HLGLLLLVLHYFVELLSHMC---GLFYFSDEKY 246 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,192,079 Number of Sequences: 237096 Number of extensions: 453490 Number of successful extensions: 543 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 76,859,062 effective HSP length: 58 effective length of database: 63,107,494 effective search space used: 1325257374 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -