BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10a14 (673 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine... 29 0.10 AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14... 25 2.9 AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small... 24 3.8 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 5.0 AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease pr... 24 5.0 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 8.8 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 8.8 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 8.8 >AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine protease protein. Length = 405 Score = 29.5 bits (63), Expect = 0.10 Identities = 17/53 (32%), Positives = 23/53 (43%) Frame = +3 Query: 141 PRRVKTSVPCALARKASVTRAPFSIVSSPISCCKEGTSPTITALGESPSTAIS 299 P ++K S+P K S T P+S P C G T G+S S +S Sbjct: 307 PIKLKLSLPYVEREKCSKTFRPWSFALGPGQMCAGGERAKDTCAGDSGSPLMS 359 >AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14D protein. Length = 360 Score = 24.6 bits (51), Expect = 2.9 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +3 Query: 234 CCKEGTSPTITALGESPSTAISLKTRISPLSTLDLASSPW 353 CC S T+L ESP+ + L R+ + PW Sbjct: 82 CCAGVRSKGKTSLPESPNCGVQLTDRVLGGQPTKIDEFPW 121 >AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small GTPase protein. Length = 190 Score = 24.2 bits (50), Expect = 3.8 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +1 Query: 376 WFPVLHHHCQD 408 W+P + HHC D Sbjct: 100 WYPEIKHHCPD 110 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 5.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 410 SWLDGRHVVFGNVVEGMEVVKQIETFGSQSGKTSK 514 SWL HV V E +V+ +GS S +T+K Sbjct: 3198 SWLLLAHVAPAAVREVKRIVQNFFGWGSSSSRTTK 3232 >AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease protein. Length = 355 Score = 23.8 bits (49), Expect = 5.0 Identities = 11/40 (27%), Positives = 15/40 (37%) Frame = +3 Query: 234 CCKEGTSPTITALGESPSTAISLKTRISPLSTLDLASSPW 353 CC ++ SP I + RI T +L PW Sbjct: 77 CCASEQQTRTSSFPTSPECGIQVTDRIIGGQTTELEEFPW 116 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 95 HRQQ*RRRILVVETFCRY*QCKQFTK 18 H QQ + ++ FCR +CK+ K Sbjct: 427 HHQQVHNQQRILYCFCRNVECKELEK 452 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.0 bits (47), Expect = 8.8 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +3 Query: 249 TSPTITALGESPSTAISLKTRISPLSTLDLASSPW 353 T+PT TA G + + +S ++L L SP+ Sbjct: 524 TAPTATAAGTAKARKVSAGVATIQKASLSLPGSPF 558 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 471 LTTSMPSTTFPKTTCLPSSQEVLTV 397 L+ ++ T F + CLP+S+E TV Sbjct: 226 LSETVEFTDFIRPICLPTSEESRTV 250 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 769,908 Number of Sequences: 2352 Number of extensions: 17199 Number of successful extensions: 35 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -