BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10a13 (255 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0498 - 25654988-25655168,25658149-25658257,25658376-256584... 59 6e-10 04_04_0496 + 25631832-25631972,25632094-25632160,25634993-256350... 59 6e-10 01_07_0064 + 40834649-40834786,40834934-40834997,40835333-408353... 58 7e-10 04_04_0224 - 23738105-23738273,23738364-23738472,23738702-237388... 58 1e-09 04_04_0216 - 23691007-23691187,23691273-23691381,23691627-236917... 57 2e-09 01_06_1110 - 34582267-34582468,34582732-34582819,34589337-345894... 57 2e-09 04_04_0223 - 23723055-23723223,23723316-23723424,23723588-237236... 56 4e-09 01_06_1111 - 34599014-34599215,34599378-34599497,34599654-345997... 56 4e-09 10_05_0036 + 8443957-8444112,8446063-8446129,8446685-8446743,844... 56 5e-09 04_04_0221 - 23710739-23710964,23711050-23711158,23711371-237114... 56 5e-09 04_04_0219 - 23703579-23703747,23703836-23703944,23704170-237042... 56 5e-09 03_05_0832 - 28037047-28037315,28037428-28037530,28037664-280376... 56 5e-09 05_04_0044 + 17470457-17470613,17470696-17470789,17471069-174711... 55 7e-09 04_04_0495 - 25623562-25623775,25623902-25624004,25624129-256242... 55 9e-09 07_03_1537 + 27562097-27562340,27562436-27562494,27562605-275626... 54 1e-08 05_04_0043 + 17450999-17451181,17451353-17451416,17451642-174517... 54 2e-08 03_02_0139 - 5844107-5844278,5844413-5844521,5844630-5844732,584... 54 2e-08 03_05_0833 - 28045442-28045881,28045961-28046063,28046172-280462... 54 2e-08 01_05_0062 + 17755460-17755522,17756878-17756953,17757074-177571... 53 3e-08 09_04_0702 - 19587943-19588168,19588423-19588525,19588809-195889... 51 1e-07 06_02_0148 - 12280794-12280962,12281102-12281210,12281283-122813... 50 3e-07 06_03_1162 + 28093749-28093851,28093939-28093997,28094691-280947... 48 8e-07 01_06_1668 + 38998348-38998434,38999234-38999300,38999377-389994... 48 1e-06 05_04_0041 + 17434459-17434514,17434670-17434904 46 6e-06 09_04_0703 - 19614057-19614264,19615305-19615407,19615880-196159... 45 1e-05 12_02_0067 + 13144002-13144203,13144471-13144529,13144638-131447... 44 1e-05 05_04_0039 + 17421826-17421966,17422105-17422168,17422562-174226... 44 2e-05 05_04_0036 + 17386160-17386318,17386588-17386651,17387089-173871... 43 3e-05 08_02_1201 - 25243516-25243681,25243784-25243892,25244046-252441... 43 4e-05 03_02_0843 - 11690176-11690820,11690930-11690961,11691115-11691235 42 7e-05 11_06_0734 - 26774471-26774652,26775008-26775137,26775447-267755... 41 2e-04 05_04_0038 + 17403620-17403769,17403975-17404038,17404807-174048... 40 3e-04 09_04_0586 - 18736643-18736914,18737085-18737187,18737279-187379... 38 0.001 08_02_1202 - 25253175-25253340,25255573-25255681,25256021-252561... 38 0.001 09_04_0585 - 18720407-18720693,18721411-18721513,18721642-187222... 37 0.003 04_04_0913 + 29363908-29363942,29364355-29364607,29364666-293649... 29 0.52 02_04_0560 - 23875475-23875573,23876005-23876125,23876409-238764... 28 1.2 09_04_0439 - 17594131-17594271,17595018-17595100,17595199-175953... 26 3.6 07_01_1139 - 10684647-10685837,10685877-10686251,10686351-106865... 26 3.6 05_01_0595 + 5344721-5345249,5349183-5349264,5349813-5350507,535... 25 6.4 11_01_0547 + 4314858-4315033,4315898-4316075,4317240-4317419 25 8.4 08_02_0163 + 13470178-13470335,13470635-13470656,13470885-134710... 25 8.4 03_03_0192 - 15308602-15308869,15309457-15309528,15310271-153103... 25 8.4 02_05_0354 - 28245422-28245844 25 8.4 01_01_0069 + 536787-537068,537193-537493,537528-537581,538848-53... 25 8.4 >04_04_0498 - 25654988-25655168,25658149-25658257,25658376-25658478, 25658634-25658883,25659011-25659126,25659332-25659587, 25659713-25659800,25659951-25660025,25660143-25660218, 25660308-25660366,25660972-25661038,25668502-25668810 Length = 562 Score = 58.8 bits (136), Expect = 6e-10 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILRS 143 AWS++DNFEWL GYT RFGLY +D+ + R+P+ SA YKE L++ Sbjct: 513 AWSVVDNFEWLFGYTLRFGLYYIDYR--TQERSPKLSALWYKEFLQN 557 >04_04_0496 + 25631832-25631972,25632094-25632160,25634993-25635054, 25636173-25636248,25636355-25636429,25637768-25637825, 25637955-25638207,25639030-25639037,25639159-25639411, 25639503-25639605,25639750-25639852,25639947-25640160 Length = 470 Score = 58.8 bits (136), Expect = 6e-10 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILRS 143 AWS++DNFEW+ GYT +FGLY+VDF + R PR SA Y++ L S Sbjct: 410 AWSIVDNFEWVYGYTVKFGLYQVDFD--TQERIPRMSAKWYRDFLTS 454 >01_07_0064 + 40834649-40834786,40834934-40834997,40835333-40835391, 40835602-40835677,40835775-40835846,40837641-40837728, 40838239-40838497,40838766-40839000,40839447-40839470, 40839910-40839997,40840110-40840300,40841082-40841322, 40841803-40842556 Length = 762 Score = 58.4 bits (135), Expect = 7e-10 Identities = 26/52 (50%), Positives = 35/52 (67%) Frame = +3 Query: 6 WSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILRSRVIDHD 161 WS +D FE+L GY + +GLY VDF+D +RPR R SA Y L++R +D D Sbjct: 379 WSFVDVFEYLTGYGQSYGLYRVDFADESRPRQARLSARWYSGFLKNREMDVD 430 >04_04_0224 - 23738105-23738273,23738364-23738472,23738702-23738804, 23738895-23738926,23739342-23739592,23739639-23739754, 23740271-23740526,23740760-23740847,23740985-23741062, 23741238-23741313,23741532-23741590,23742639-23742711 Length = 469 Score = 57.6 bits (133), Expect = 1e-09 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILR 140 AWSL+DNFEW GYT RFG+ VD++D A+ R P+ SA +KE L+ Sbjct: 424 AWSLLDNFEWSNGYTVRFGINFVDYNDGAK-RYPKMSAHWFKEFLQ 468 >04_04_0216 - 23691007-23691187,23691273-23691381,23691627-23691729, 23691829-23691860,23692012-23692229,23692299-23692420 Length = 254 Score = 57.2 bits (132), Expect = 2e-09 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILR 140 AWSL+DNFEW +GYT RFGL VD+ D + R P+ SA +K+ LR Sbjct: 205 AWSLLDNFEWADGYTLRFGLNFVDYDDGMK-RHPKNSAHWFKKFLR 249 >01_06_1110 - 34582267-34582468,34582732-34582819,34589337-34589439, 34589886-34589914,34590114-34590144,34590621-34590822, 34591424-34591539,34591784-34592006,34592151-34592238, 34592336-34592407,34592485-34592560,34593822-34593880, 34595341-34595404,34595487-34595618 Length = 494 Score = 56.8 bits (131), Expect = 2e-09 Identities = 25/47 (53%), Positives = 31/47 (65%) Frame = +3 Query: 6 WSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILRSR 146 WS +D +E LEGY R GLY VDF D ARPR R+SA Y + L+ + Sbjct: 439 WSFVDVYELLEGYQSRSGLYRVDFDDGARPRRARRSARWYSDFLKGK 485 >04_04_0223 - 23723055-23723223,23723316-23723424,23723588-23723690, 23723781-23723812,23724024-23724241,23724322-23724437, 23725055-23725310,23725719-23725806,23725928-23726005, 23726199-23726274,23726525-23726583,23727715-23728066 Length = 551 Score = 56.0 bits (129), Expect = 4e-09 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEIL 137 AWSL+DNFEW GYT RFG+ VD++D R R P+ SA +K+ L Sbjct: 506 AWSLLDNFEWSNGYTVRFGINFVDYND-GRKRYPKNSAHWFKKFL 549 >01_06_1111 - 34599014-34599215,34599378-34599497,34599654-34599760, 34600452-34600480,34600768-34600982,34601215-34601330, 34601960-34602218,34602342-34602429,34602932-34603003, 34603080-34603155,34603579-34603637,34603937-34604000, 34604104-34604232 Length = 511 Score = 56.0 bits (129), Expect = 4e-09 Identities = 24/48 (50%), Positives = 32/48 (66%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILRSR 146 AW +D FE L GY R+GLY VDF D A PR ++SA Y++ L+S+ Sbjct: 455 AWFFVDMFELLSGYQTRYGLYRVDFDDAALPRRAKRSARWYRDFLKSK 502 >10_05_0036 + 8443957-8444112,8446063-8446129,8446685-8446743, 8446855-8446930,8447118-8447189,8447326-8447413, 8447489-8447744,8447934-8448049,8448247-8448470, 8448685-8448716,8448882-8449018,8449200-8449289, 8449383-8449557 Length = 515 Score = 55.6 bits (128), Expect = 5e-09 Identities = 25/47 (53%), Positives = 32/47 (68%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILRS 143 AWSL+DN+EW GYT RFGLY VD+ + R R P+ S +K +L S Sbjct: 469 AWSLLDNWEWAAGYTSRFGLYYVDYKN--RKRYPKNSVQWFKNLLAS 513 >04_04_0221 - 23710739-23710964,23711050-23711158,23711371-23711473, 23711568-23711599,23711707-23711924,23711994-23712109, 23714696-23714843,23715713-23715800,23715935-23716019 Length = 374 Score = 55.6 bits (128), Expect = 5e-09 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILR 140 AWSL+DNFEW EGYT RFG+ VD+ D + R P+ SA +K+ L+ Sbjct: 310 AWSLLDNFEWAEGYTVRFGINFVDYDDGMK-RYPKNSARWFKKFLQ 354 >04_04_0219 - 23703579-23703747,23703836-23703944,23704170-23704272, 23704365-23704396,23704855-23705072,23706295-23706618, 23706982-23707069,23707179-23707263 Length = 375 Score = 55.6 bits (128), Expect = 5e-09 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILR 140 AWSL+DNFEW EGYT RFG+ VD+ D R P+ SA +K+ LR Sbjct: 330 AWSLLDNFEWSEGYTVRFGINFVDY-DNGMKRYPKNSARWFKKFLR 374 >03_05_0832 - 28037047-28037315,28037428-28037530,28037664-28037695, 28037788-28038005,28038145-28038260,28038514-28038757, 28039129-28039216,28039513-28039588,28040126-28040164, 28040347-28040405,28041292-28041529 Length = 493 Score = 55.6 bits (128), Expect = 5e-09 Identities = 23/46 (50%), Positives = 34/46 (73%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILR 140 AWSL+DNFEWL GYT +FG+ VDF+ R P+ SA+ ++++L+ Sbjct: 449 AWSLLDNFEWLSGYTSKFGIVYVDFN--TLERHPKASAYWFRDMLK 492 >05_04_0044 + 17470457-17470613,17470696-17470789,17471069-17471132, 17471378-17471477,17472027-17472085,17472572-17472647, 17472761-17472832,17473788-17473932,17474044-17474299, 17475190-17475305,17475503-17475723,17475996-17476024, 17476622-17476740,17476828-17477023,17477242-17477250 Length = 570 Score = 55.2 bits (127), Expect = 7e-09 Identities = 24/48 (50%), Positives = 30/48 (62%) Frame = +3 Query: 6 WSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILRSRV 149 WS +D FE GY FGL+ VDF DP+ PR P+ SA Y + LRS + Sbjct: 514 WSFLDVFELFAGYHSPFGLHHVDFEDPSLPRQPKLSAQWYSKFLRSEI 561 >04_04_0495 - 25623562-25623775,25623902-25624004,25624129-25624231, 25624353-25624562 Length = 209 Score = 54.8 bits (126), Expect = 9e-09 Identities = 25/52 (48%), Positives = 33/52 (63%) Frame = +3 Query: 6 WSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILRSRVIDHD 161 WSL+DNFEW+ GYT +FGLY VDF + R P+ SA Y++ L + D Sbjct: 150 WSLIDNFEWVFGYTIKFGLYHVDFD--TQERIPKMSAKWYRDFLTGSNVTDD 199 >07_03_1537 + 27562097-27562340,27562436-27562494,27562605-27562680, 27562776-27562847,27562934-27563021,27563118-27563361, 27563490-27563605,27563783-27564000,27564113-27564144, 27564262-27564364,27564471-27564751 Length = 510 Score = 54.4 bits (125), Expect = 1e-08 Identities = 25/48 (52%), Positives = 32/48 (66%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILRSR 146 AWSL+DNFEW GYT RFG+ VD+ R P+ SAF +K +L S+ Sbjct: 462 AWSLLDNFEWRLGYTSRFGIVYVDYK--TLKRYPKDSAFWFKNMLSSK 507 >05_04_0043 + 17450999-17451181,17451353-17451416,17451642-17451700, 17452331-17452406,17452469-17452597,17453524-17453611, 17453711-17453966,17454308-17454423,17454569-17454789, 17454977-17455005,17455167-17455273,17455778-17456015 Length = 521 Score = 54.0 bits (124), Expect = 2e-08 Identities = 24/48 (50%), Positives = 29/48 (60%) Frame = +3 Query: 6 WSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILRSRV 149 WS +D FE L GY FGL+ VDF DP PR P+ SA Y + LR + Sbjct: 454 WSFLDVFELLAGYHSPFGLHYVDFEDPNLPRQPKLSAHWYSKFLRGEI 501 >03_02_0139 - 5844107-5844278,5844413-5844521,5844630-5844732, 5844834-5844865,5845211-5845434,5845774-5845889, 5845997-5846252,5846720-5846807,5846891-5846962, 5847096-5847171,5847302-5847360,5848202-5848268, 5848760-5848825,5850466-5850657 Length = 543 Score = 54.0 bits (124), Expect = 2e-08 Identities = 23/47 (48%), Positives = 33/47 (70%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILRS 143 AWSL+DN+EW GY+ RFGLY VD+ D + R P+ S +K +L++ Sbjct: 498 AWSLLDNWEWAAGYSSRFGLYFVDYKDNLK-RYPKNSVQWFKALLKT 543 >03_05_0833 - 28045442-28045881,28045961-28046063,28046172-28046203, 28046299-28046516,28046606-28046721,28047757-28048000, 28048423-28048510,28048596-28048667,28048758-28048869, 28049047-28049115,28049627-28049685,28050067-28050325 Length = 603 Score = 53.6 bits (123), Expect = 2e-08 Identities = 24/47 (51%), Positives = 33/47 (70%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILRS 143 AWSL+DNFEWL GYT +FG+ VDF+ R P+ SA +K +L++ Sbjct: 502 AWSLLDNFEWLSGYTSKFGIVYVDFT--TLKRYPKDSANWFKNMLQA 546 >01_05_0062 + 17755460-17755522,17756878-17756953,17757074-17757145, 17757274-17757361,17757793-17758033,17759461-17759576, 17759804-17760021,17760210-17760241,17760338-17760440, 17760531-17760805 Length = 427 Score = 53.2 bits (122), Expect = 3e-08 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILRSR 146 AWSL+DNFEW GYT RFGL VDF R P+ SA+ +++++ S+ Sbjct: 381 AWSLLDNFEWKLGYTSRFGLVYVDFR--TLRRYPKMSAYWFRDLVSSK 426 >09_04_0702 - 19587943-19588168,19588423-19588525,19588809-19588923, 19589061-19589086,19589178-19589398,19589493-19589608, 19589695-19589953,19590052-19590139,19590236-19590307, 19590401-19590476,19590746-19590809,19591139-19591259, 19592391-19592451,19592682-19592828 Length = 564 Score = 51.2 bits (117), Expect = 1e-07 Identities = 25/45 (55%), Positives = 28/45 (62%) Frame = +3 Query: 6 WSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILR 140 WS +D FE+L GY RFGLY VDF+ P R R R SA Y LR Sbjct: 501 WSFLDVFEYLFGYRLRFGLYGVDFASPERTRYQRHSARWYAGFLR 545 >06_02_0148 - 12280794-12280962,12281102-12281210,12281283-12281385, 12281587-12281618,12281709-12281926,12282035-12282150, 12282428-12282683,12282912-12282999,12283393-12283468, 12283562-12283620,12285236-12285305,12285399-12285539 Length = 478 Score = 49.6 bits (113), Expect = 3e-07 Identities = 19/38 (50%), Positives = 29/38 (76%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSA 116 AWSL DNFEW++GY+ RFG+ +D+ D + R P++S+ Sbjct: 433 AWSLFDNFEWMDGYSVRFGINYIDYKDGLK-RYPKRSS 469 >06_03_1162 + 28093749-28093851,28093939-28093997,28094691-28094766, 28094848-28094919,28095023-28095110,28095230-28095485, 28095583-28095698,28096064-28096127,28096252-28096354, 28096446-28096554,28097048-28097234 Length = 410 Score = 48.4 bits (110), Expect = 8e-07 Identities = 20/47 (42%), Positives = 30/47 (63%) Frame = +3 Query: 6 WSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILRSR 146 WSL+DN+EW GYT RFGLY +D+ + R P+ S + ++L + Sbjct: 361 WSLLDNWEWNSGYTVRFGLYYIDYKNNL-TRIPKASVQWFSQVLAQK 406 >01_06_1668 + 38998348-38998434,38999234-38999300,38999377-38999435, 38999636-38999711,38999856-38999930,39000007-39000094, 39000261-39000486,39000689-39000804,39001172-39001383, 39001882-39001916,39002005-39002107,39002645-39002753, 39002838-39003036 Length = 483 Score = 48.0 bits (109), Expect = 1e-06 Identities = 21/46 (45%), Positives = 29/46 (63%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILR 140 AWS +DNFEW GYT+RFG+ VD+ + R P+ SA + L+ Sbjct: 428 AWSFLDNFEWAMGYTKRFGIVYVDYKN-GLSRHPKASARWFSRFLK 472 >05_04_0041 + 17434459-17434514,17434670-17434904 Length = 96 Score = 45.6 bits (103), Expect = 6e-06 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +3 Query: 6 WSLMDNFEWLEGY-TERFGLYEVDFSDPARPRTPRKSAFVYKEILRSRVI 152 WS MD +E GY T +GL VDFS R R PR+SA Y + L++ + Sbjct: 30 WSFMDLYELFGGYNTWHYGLIAVDFSSAERRRQPRRSASWYSDFLKNNAV 79 >09_04_0703 - 19614057-19614264,19615305-19615407,19615880-19615973, 19616216-19616229,19616384-19616595,19617653-19617940, 19618275-19618362,19618444-19618515,19618597-19618672, 19618755-19618813,19618953-19619016,19619253-19619402 Length = 475 Score = 44.8 bits (101), Expect = 1e-05 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = +3 Query: 6 WSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILR 140 WS+ D FE+L GY RFGL VDF+ AR R + SA Y LR Sbjct: 418 WSMFDMFEFLYGYRLRFGLCGVDFTAAARTRYLKNSARWYSGFLR 462 >12_02_0067 + 13144002-13144203,13144471-13144529,13144638-13144713, 13144802-13144873,13144969-13145056,13145365-13145601, 13145705-13145910,13145946-13146122,13146220-13146251, 13146330-13146432,13146547-13146815,13148029-13148175, 13148272-13148412,13148509-13148595,13148841-13148931, 13149093-13149192,13149292-13149352,13149442-13149663, 13149756-13149872,13149972-13150061,13150168-13150344 Length = 917 Score = 44.4 bits (100), Expect = 1e-05 Identities = 20/49 (40%), Positives = 32/49 (65%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILRSRV 149 AWSL+DNFEW G+T +FG+ VD S R P+ S ++++++S + Sbjct: 462 AWSLLDNFEWRLGFTSKFGIVYVDRS--TFTRYPKDSTRWFRKMIKSEL 508 >05_04_0039 + 17421826-17421966,17422105-17422168,17422562-17422620, 17423410-17423536,17425029-17425116,17425196-17425451, 17425565-17425680,17426232-17426328,17426636-17426771, 17426892-17426979,17427133-17427367 Length = 468 Score = 44.0 bits (99), Expect = 2e-05 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +3 Query: 6 WSLMDNFEWLEGY-TERFGLYEVDFSDPARPRTPRKSAFVYKEILRSRVI 152 WS +D +E GY T FGL VDF R R PR+SA Y E L++ + Sbjct: 402 WSFVDLYELFGGYSTWHFGLVAVDFDSEKRRRQPRRSASWYSEFLKNNSV 451 >05_04_0036 + 17386160-17386318,17386588-17386651,17387089-17387147, 17387268-17387343,17387521-17387592,17387786-17387873, 17387992-17388250,17388446-17388561,17388876-17389096, 17389196-17389224,17389285-17389420,17389567-17389651, 17389735-17389963 Length = 530 Score = 43.2 bits (97), Expect = 3e-05 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +3 Query: 6 WSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILRSRVI 152 WS MD +E Y FG+ VDF R PR+SA Y + L++ + Sbjct: 466 WSFMDQYEMFGDYKAHFGIVAVDFGSEELTRQPRRSARWYSDFLKNNAV 514 >08_02_1201 - 25243516-25243681,25243784-25243892,25244046-25244148, 25244273-25244304,25244405-25244625,25244948-25245063, 25245149-25245404,25245916-25246003,25246133-25246210, 25246541-25246659,25246893-25246942,25247117-25247245 Length = 488 Score = 42.7 bits (96), Expect = 4e-05 Identities = 20/45 (44%), Positives = 29/45 (64%) Frame = +3 Query: 6 WSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILR 140 W+ MD+FEW +GYT RFGL VD R R +KS++ + + L+ Sbjct: 445 WTFMDDFEWGDGYTGRFGLIYVDRETLKRYR--KKSSYWFADFLK 487 >03_02_0843 - 11690176-11690820,11690930-11690961,11691115-11691235 Length = 265 Score = 41.9 bits (94), Expect = 7e-05 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +3 Query: 3 AWSLMDNFEWLEGYTERFGLYEVD 74 AWSL+DNFEW GYT RFG+ V+ Sbjct: 169 AWSLLDNFEWRLGYTSRFGIVYVE 192 >11_06_0734 - 26774471-26774652,26775008-26775137,26775447-26775596, 26775685-26775918,26775990-26776161,26776285-26776506, 26776604-26776770,26776880-26777018,26777342-26777693, 26778175-26778370 Length = 647 Score = 40.7 bits (91), Expect = 2e-04 Identities = 17/44 (38%), Positives = 27/44 (61%) Frame = +3 Query: 6 WSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEIL 137 W+ DN+EW +GY +FGL VD ++ R PR S F++ ++ Sbjct: 504 WTTSDNWEWADGYGPKFGLVAVDRANNL-ARKPRPSYFLFSRVV 546 >05_04_0038 + 17403620-17403769,17403975-17404038,17404807-17404865, 17404981-17405056,17405196-17405267,17405411-17405498, 17405617-17405872,17405972-17406087,17406757-17406977, 17407074-17407102,17407192-17407291,17407405-17407492, 17407640-17407874 Length = 517 Score = 39.9 bits (89), Expect = 3e-04 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 6 WSLMDNFEWLEGYTE-RFGLYEVDFSDPARPRTPRKSAFVYKEILRS 143 WS +D +E GY +GL VDF R R PR+SA Y + L++ Sbjct: 451 WSFIDIYEIFGGYNSWHYGLVAVDFGSTERRRQPRRSASWYSDFLKN 497 >09_04_0586 - 18736643-18736914,18737085-18737187,18737279-18737900, 18738376-18738463,18738537-18738614,18738741-18738816, 18738912-18738970,18739061-18739127,18739268-18739405 Length = 500 Score = 37.9 bits (84), Expect = 0.001 Identities = 18/45 (40%), Positives = 28/45 (62%) Frame = +3 Query: 6 WSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILR 140 W+ MD FEW +GY +RFGL VD R R ++S++ ++ L+ Sbjct: 456 WTFMDCFEWGDGYLDRFGLIYVDRKTLKRYR--KESSYWIEDFLK 498 >08_02_1202 - 25253175-25253340,25255573-25255681,25256021-25256123, 25256246-25256277,25257697-25258178,25258946-25259025, 25259107-25259165,25259341-25259413,25259526-25259660 Length = 412 Score = 37.9 bits (84), Expect = 0.001 Identities = 19/45 (42%), Positives = 30/45 (66%) Frame = +3 Query: 6 WSLMDNFEWLEGYTERFGLYEVDFSDPARPRTPRKSAFVYKEILR 140 W+ MD FE+ +G+ +RFGL VD + AR R +KS++ + + LR Sbjct: 369 WTFMDCFEFGDGFKDRFGLIYVDRATLARFR--KKSSYWFADFLR 411 >09_04_0585 - 18720407-18720693,18721411-18721513,18721642-18722263, 18722602-18722689,18722815-18722892,18723116-18723191, 18723697-18723755,18723907-18723964,18724070-18724216 Length = 505 Score = 36.7 bits (81), Expect = 0.003 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +3 Query: 6 WSLMDNFEWLEGYTERFGLYEVD 74 W+ MD FEW +GY +RFGL +D Sbjct: 458 WTFMDCFEWGDGYLDRFGLIYID 480 >04_04_0913 + 29363908-29363942,29364355-29364607,29364666-29364983, 29365197-29365550 Length = 319 Score = 29.1 bits (62), Expect = 0.52 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +2 Query: 140 KQGHRPRLRAQHYRHDHRRGTLRQ 211 +QG RPRL + D RR TLRQ Sbjct: 33 RQGRRPRLLGERGEDDRRRVTLRQ 56 >02_04_0560 - 23875475-23875573,23876005-23876125,23876409-23876485, 23876720-23876784,23877126-23877213,23878472-23878480 Length = 152 Score = 27.9 bits (59), Expect = 1.2 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -3 Query: 214 ILSQCPSSMVMTVVLGS*SWSMTLLLKISL*TKADLRGV 98 IL + PSS V+TV GS +W M + SL +++G+ Sbjct: 18 ILPRDPSSFVLTVKHGSDAWFMPGFMDSSLKNTNNMQGI 56 >09_04_0439 - 17594131-17594271,17595018-17595100,17595199-17595355, 17595438-17595576,17595668-17595720,17596150-17596257, 17596345-17596413,17596505-17596570,17596651-17596794, 17597372-17597455,17597539-17597637,17597753-17597875, 17598283-17598831 Length = 604 Score = 26.2 bits (55), Expect = 3.6 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +2 Query: 89 PPSHPAQVRLRLQGDLEKQGHRPRLRAQHYRHDHRRGT 202 PPS A RLRL+ L + RLRA H D R + Sbjct: 10 PPSSSAACRLRLRRQLLLRPSHLRLRAPHSIADLSRSS 47 >07_01_1139 - 10684647-10685837,10685877-10686251,10686351-10686534, 10686699-10686895 Length = 648 Score = 26.2 bits (55), Expect = 3.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 129 EILRSRVIDHDYEPNTTVMTID 194 ++L R+ DHD P TVM +D Sbjct: 137 DLLMKRLDDHDKRPQGTVMALD 158 >05_01_0595 + 5344721-5345249,5349183-5349264,5349813-5350507, 5350583-5350839,5350934-5351615,5351689-5351892, 5351981-5352715,5352799-5353181 Length = 1188 Score = 25.4 bits (53), Expect = 6.4 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +2 Query: 80 GSRPPSHPAQVRLRLQGDLEKQGHRPRLRAQHYRHDHRRG 199 G+ P HP +VR + GD+ PR R H RG Sbjct: 72 GAPPCRHPHRVRCVILGDIHAPPRHPRRRCVR-GHGRLRG 110 >11_01_0547 + 4314858-4315033,4315898-4316075,4317240-4317419 Length = 177 Score = 25.0 bits (52), Expect = 8.4 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -1 Query: 87 RDPKSQPRTNRNVRCILP-TIRSYPSDSRP 1 R+ + PRT+R RC+ P + Y S + P Sbjct: 81 REHSTYPRTSRRTRCLKPFKVPEYCSHNTP 110 >08_02_0163 + 13470178-13470335,13470635-13470656,13470885-13471055, 13471157-13471363,13471458-13471700 Length = 266 Score = 25.0 bits (52), Expect = 8.4 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 108 CAGCEGGRDPKSQPRTNRNVR 46 C GC GGR P+S+ R Sbjct: 31 CGGCVGGRPPQSRVEAEGKTR 51 >03_03_0192 - 15308602-15308869,15309457-15309528,15310271-15310337, 15310449-15310528,15310636-15310714,15310815-15310890 Length = 213 Score = 25.0 bits (52), Expect = 8.4 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 86 RPPSHPAQVRLRLQGDLEKQGHRPRLRAQHYRHDHR 193 R S + R + D +G+R R +HYR D++ Sbjct: 114 RGRSRSPSPKRRYRADYRDRGYRDDYRDRHYRDDYQ 149 >02_05_0354 - 28245422-28245844 Length = 140 Score = 25.0 bits (52), Expect = 8.4 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 143 QGHRPRLRAQHYRHDH 190 QGH PRL +H R H Sbjct: 100 QGHHPRLTVRHRRQRH 115 >01_01_0069 + 536787-537068,537193-537493,537528-537581,538848-539241, 539345-539595,539678-539798,539893-540133,540341-540445, 540571-540615,540738-540890,541132-541410,541705-541841, 541975-542017,542228-542329 Length = 835 Score = 25.0 bits (52), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +3 Query: 108 KSAFVYKEILRSRV--IDHDYEPNTTVMTIDEGH 203 K AFV +L+ + + HDY P T++T H Sbjct: 17 KHAFVDYSLLKKDLKRMQHDYSPQGTIITTSTPH 50 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,530,613 Number of Sequences: 37544 Number of extensions: 86172 Number of successful extensions: 314 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 313 length of database: 14,793,348 effective HSP length: 63 effective length of database: 12,428,076 effective search space used: 260989596 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -