BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10a05 (547 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54575| Best HMM Match : S10_plectin (HMM E-Value=0) 192 2e-49 SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) 30 1.1 SB_48479| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_37766| Best HMM Match : IncA (HMM E-Value=0.4) 29 1.9 SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_3936| Best HMM Match : Collagen (HMM E-Value=7.5e-24) 28 5.7 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_58477| Best HMM Match : Ion_trans (HMM E-Value=1.2e-25) 27 7.6 SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_54575| Best HMM Match : S10_plectin (HMM E-Value=0) Length = 166 Score = 192 bits (468), Expect = 2e-49 Identities = 98/160 (61%), Positives = 117/160 (73%), Gaps = 4/160 (2%) Frame = +1 Query: 58 MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 237 ML+PK+NRV IYEYLFKEGV VAKKD+++PKHT++E +PNL VIKA+QSLKSRGYV+E+F Sbjct: 1 MLIPKKNRVIIYEYLFKEGVCVAKKDFNSPKHTQIENVPNLHVIKALQSLKSRGYVEEKF 60 Query: 238 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSV-RTETVRRGPVGR--PDAPARSAE 408 W+H+YW LTNEGI YLR FLHLP EIVPATL+R V R ET R P G P P + Sbjct: 61 CWKHYYWNLTNEGITYLRDFLHLPTEIVPATLRRQVTRAETARPRPKGMDGPRGPGEGGD 120 Query: 409 -DRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRG 525 DR +YRR P PGV + K G G EF+ G+GRG Sbjct: 121 RDRESYRRGP-PPGV---EGKGGAGSGFKP-EFRQGFGRG 155 >SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 2075 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/22 (59%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = +1 Query: 427 RTPAAPGVAPHDK-KADVGPGS 489 +TPA PG+AP D K VGPG+ Sbjct: 365 KTPALPGIAPSDALKGTVGPGN 386 >SB_48479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 29.9 bits (64), Expect = 1.4 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 86 ATRFCLGINILKAACRLT*HRKEQGD 9 + RFCLGIN+L C++ QGD Sbjct: 279 SNRFCLGINLLLRTCKVEQENGMQGD 304 >SB_37766| Best HMM Match : IncA (HMM E-Value=0.4) Length = 585 Score = 29.5 bits (63), Expect = 1.9 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +1 Query: 436 AAPGVAPHDKKADVGP 483 A PG+APHDKK+ GP Sbjct: 545 ARPGLAPHDKKSGKGP 560 >SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1705 Score = 27.9 bits (59), Expect = 5.7 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +1 Query: 364 RGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGP 483 +GP+G P P + R P PG P K+ + GP Sbjct: 199 QGPIGPPGRPGPKGPKDTCPRCPPGPPG--PKGKRGETGP 236 >SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 27.9 bits (59), Expect = 5.7 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 4/53 (7%) Frame = +1 Query: 301 HLPPEIVPATLKRSVRTETVRRGPVGRPDAP----ARSAEDRSAYRRTPAAPG 447 HL P ++ + S+ RGP GRP P R + R P +PG Sbjct: 110 HLSPAVIRLCMGGSLTCPPGPRGPPGRPGHPGQKGTRGRRGQRGRRGNPGSPG 162 >SB_3936| Best HMM Match : Collagen (HMM E-Value=7.5e-24) Length = 270 Score = 27.9 bits (59), Expect = 5.7 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +1 Query: 364 RGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGP 483 +GP+G P P + R P PG P K+ + GP Sbjct: 199 QGPIGPPGRPGPKGPKDTCPRCPPGPPG--PKGKRGETGP 236 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 27.5 bits (58), Expect = 7.6 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 82 VAIYEYLFKEGVMVAKKDYHAPKHTELEKIPN 177 +A +++L K + + APK +EK+PN Sbjct: 1395 IADFDFLSKSAIQALRLPVPAPKVNNMEKVPN 1426 >SB_58477| Best HMM Match : Ion_trans (HMM E-Value=1.2e-25) Length = 578 Score = 27.5 bits (58), Expect = 7.6 Identities = 19/73 (26%), Positives = 37/73 (50%) Frame = +1 Query: 130 KDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIEYLRIFLHLP 309 +DY A T I + ++ + + SRG+VK+ +A+ W + + +L +L L Sbjct: 118 EDYDASGGTVY--ITAIYTLEMICKIISRGFVKDSYAYLRDTWNWLDSLVVFLS-YLSLA 174 Query: 310 PEIVPATLKRSVR 348 P+I + R++R Sbjct: 175 PDIASLSGIRTLR 187 >SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6406 Score = 27.5 bits (58), Expect = 7.6 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +1 Query: 376 GRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGS 489 G P+ + S+E R RT AP P K PG+ Sbjct: 6325 GEPEGTSPSSESRIPVGRTTKAPTTKPASKTTTTRPGT 6362 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,488,679 Number of Sequences: 59808 Number of extensions: 321666 Number of successful extensions: 1077 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1077 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -