BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10a05 (547 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 25 1.6 L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 25 2.2 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 25 2.2 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 2.8 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 24 3.8 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 24 3.8 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 5.0 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 5.0 Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor pr... 23 6.6 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 25.0 bits (52), Expect = 1.6 Identities = 20/58 (34%), Positives = 24/58 (41%), Gaps = 5/58 (8%) Frame = +1 Query: 364 RGPVGRPDAPARSAED----RSAYRRTPAAPGV-APHDKKADVGPGSADLEFKGGYGR 522 +GP G P AP R D + APGV +K D+G D KG GR Sbjct: 166 KGPAGHPGAPGRPGVDGVKGLPGLKGDIGAPGVIGLPGQKGDMGQAGND-GLKGFQGR 222 Score = 24.2 bits (50), Expect = 2.8 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +1 Query: 346 RTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPG 486 R E GPVG P AP R P APG+ P K PG Sbjct: 62 RGEKGNSGPVGPPGAPGRDG--------MPGAPGL-PGSKGVKGDPG 99 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 24.6 bits (51), Expect = 2.2 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 469 ADVGPGSADLEFKG 510 ADVGPG+ + EF G Sbjct: 145 ADVGPGAGEREFNG 158 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 24.6 bits (51), Expect = 2.2 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 469 ADVGPGSADLEFKG 510 ADVGPG+ + EF G Sbjct: 145 ADVGPGAGEREFNG 158 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.2 bits (50), Expect = 2.8 Identities = 13/63 (20%), Positives = 33/63 (52%) Frame = +1 Query: 148 KHTELEKIPNLQVIKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPA 327 K+ +L+K + A+++ R Y+ + +W++T++ EY+ IF+ + + Sbjct: 1134 KNCDLDKNQRNCIEFALKAKPIRRYIPKHRIQYKVWWFVTSQPFEYM-IFVLIMINTITL 1192 Query: 328 TLK 336 ++K Sbjct: 1193 SMK 1195 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.8 bits (49), Expect = 3.8 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 301 HLPPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSA 420 +LP I P L+ + RR +G D P S+ + SA Sbjct: 455 YLPASINPVKLRETSTIRRQRRTALGNRDEPHSSSGNWSA 494 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 23.8 bits (49), Expect = 3.8 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 301 HLPPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSA 420 +LP I P L+ + RR +G D P S+ + SA Sbjct: 456 YLPASINPVKLRETSTIRRQRRTALGNRDEPHSSSGNWSA 495 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +1 Query: 460 DKKADVGPGSADLEFKGGYGRGRP 531 DK + P S K GYG G P Sbjct: 678 DKLLNTMPASPASSIKSGYGEGAP 701 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.4 bits (48), Expect = 5.0 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -1 Query: 517 HSLP*IQDQLSLDQHQPFYHEVQHQGQQEY 428 H LP Q Q +H P + H QQ+Y Sbjct: 604 HYLPLQQQQQQQARHLPQQQAIHHIHQQQY 633 >Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor protein. Length = 327 Score = 23.0 bits (47), Expect = 6.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 108 RGSHGGQKRLSCTEAY*T 161 + HGG+ R+ TEAY T Sbjct: 9 QAEHGGETRVIMTEAYST 26 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 551,600 Number of Sequences: 2352 Number of extensions: 10531 Number of successful extensions: 29 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50460840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -