BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10a01 (650 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4KLQ3 Cluster: LOC100093620 protein; n=2; Xenopus|Rep:... 36 1.1 >UniRef50_Q4KLQ3 Cluster: LOC100093620 protein; n=2; Xenopus|Rep: LOC100093620 protein - Xenopus laevis (African clawed frog) Length = 642 Score = 35.5 bits (78), Expect = 1.1 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -3 Query: 243 MKPIDSNNHTAIMGRELICPSKATKT--PVNSNQSHYCTMSVPANSN 109 M P+D N HTA MG+E + P K P +S++S + AN N Sbjct: 385 MHPVDGNLHTAAMGKEPVQPKKVQPVVQPQSSSESSAFEVETDANEN 431 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 624,621,106 Number of Sequences: 1657284 Number of extensions: 12209708 Number of successful extensions: 21226 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 20683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21225 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 48760335122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -