BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10a01 (650 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF588468-1|ABQ96704.1| 176|Anopheles gambiae transposase protein. 24 3.6 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 24 3.6 >EF588468-1|ABQ96704.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.2 bits (50), Expect = 3.6 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 91 KKIFYTHNPNAILLPYATCV 32 KK FYT NPN I +P C+ Sbjct: 131 KKFFYTLNPNYI-MPTRKCL 149 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 24.2 bits (50), Expect = 3.6 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = -3 Query: 228 SNNHTAIMGRELICPSKATKTPVNSNQSHYCTMSVPANSN 109 SN + GREL PS+ + +S+Y + ++S+ Sbjct: 81 SNTFQLVQGRELTKPSRRVLEGQSERESYYSSSHYQSSSS 120 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 684,278 Number of Sequences: 2352 Number of extensions: 14442 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -