BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0994 (680 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2A9.04c |||sir antagonist ortholog |Schizosaccharomyces pomb... 28 1.1 SPAC11E3.05 |||ubiquitin-protein ligase E3|Schizosaccharomyces p... 28 1.4 SPAC13G6.08 |||Cdc20/Fizzy family WD repeat protein|Schizosaccha... 27 3.3 SPAC1B3.15c |||membrane transporter|Schizosaccharomyces pombe|ch... 26 4.4 SPAC23H4.14 |vam6|vps39|guanyl-nucleotide exchange factor Vma6|S... 26 5.8 SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc... 25 7.7 >SPBC2A9.04c |||sir antagonist ortholog |Schizosaccharomyces pombe|chr 2|||Manual Length = 741 Score = 28.3 bits (60), Expect = 1.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 494 KKSCIHLFGRKCFHKFFALHC 432 K C H+FG+ C K+ HC Sbjct: 124 KMPCGHIFGKNCLQKWLENHC 144 >SPAC11E3.05 |||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1323 Score = 27.9 bits (59), Expect = 1.4 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 5/39 (12%) Frame = +1 Query: 205 LIISCSL*NIITSNVYVCILYYSLI-----VFLCLSLYG 306 L+ C+ N TSN +C YSL+ F CLS++G Sbjct: 1236 LVNHCNSCNSTTSNTRICEKCYSLVPRMSCTFCCLSIHG 1274 >SPAC13G6.08 |||Cdc20/Fizzy family WD repeat protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 535 Score = 26.6 bits (56), Expect = 3.3 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +2 Query: 491 FFNSLMYKSKKKTLILDCPVPKYNLSKQLGPTKQKRWNRHFFYSVQYS 634 F+ SL+ S K L + Y SK+LGPT+ + + SV YS Sbjct: 192 FYTSLLSWSPKGDLAIGLAENIYLWSKELGPTRVLEESIYDVSSVAYS 239 >SPAC1B3.15c |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 628 Score = 26.2 bits (55), Expect = 4.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 570 FERLYLGTGQSKINVFFFDLYINELKKKLHTPLW 469 + L +GTG S +++ FDL N L + LW Sbjct: 198 YHTLSVGTGLSYVSLIIFDLPSNLLMTRADPRLW 231 >SPAC23H4.14 |vam6|vps39|guanyl-nucleotide exchange factor Vma6|Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 25.8 bits (54), Expect = 5.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 190 IKNIYLIISCSL*NIITSNVYVCIL 264 I NIY SC TSN YV IL Sbjct: 280 ISNIYSTFSCHKNTFFTSNSYVWIL 304 >SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1463 Score = 25.4 bits (53), Expect = 7.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 52 FVNFYLIQFDLVTESLFKRFQ 114 FV F L ++V S+FKRFQ Sbjct: 403 FVTFLLFPCNVVIASIFKRFQ 423 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,595,583 Number of Sequences: 5004 Number of extensions: 51922 Number of successful extensions: 137 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -