BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0994 (680 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1584 - 38441654-38442847 29 4.5 05_03_0658 + 16711117-16712337 28 7.9 >01_06_1584 - 38441654-38442847 Length = 397 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/56 (26%), Positives = 29/56 (51%) Frame = +2 Query: 437 VKQKIYGSIFVQRGVCSFFFNSLMYKSKKKTLILDCPVPKYNLSKQLGPTKQKRWN 604 +K+K++ SI +Q+GVC + S + ++ + +L K+ T +RWN Sbjct: 79 LKRKLFSSILLQKGVCDAYILSNLGFAEPSIFFAFAFLLHGSLQKRELGTLNQRWN 134 >05_03_0658 + 16711117-16712337 Length = 406 Score = 27.9 bits (59), Expect = 7.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -3 Query: 126 CIIWLEPFKKGLCYQIELYQIKIN 55 C +W E +KG+C + Y + IN Sbjct: 294 CAVWEEMHRKGICPDVNSYTVFIN 317 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,158,459 Number of Sequences: 37544 Number of extensions: 243223 Number of successful extensions: 477 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1721314888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -