BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0994 (680 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 25 1.7 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 5.1 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 25.4 bits (53), Expect = 1.7 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 494 FNSLMYKSKKKTLILDCPVPKYNLSKQLGPT 586 FN+LM K K + CPV ++ + L PT Sbjct: 349 FNTLMNKVKSSEPVEQCPVKLKSIIETLFPT 379 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.8 bits (49), Expect = 5.1 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -3 Query: 603 FHLFCFVGPNCFE 565 F ++CFV P+C E Sbjct: 33 FLIYCFVSPSCLE 45 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 626,703 Number of Sequences: 2352 Number of extensions: 11741 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -