BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0992 (675 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_1037 - 22477358-22478752 31 1.1 05_05_0010 - 21496089-21496487 30 1.5 12_02_0953 - 24736642-24736673,24737104-24737188,24737267-247373... 29 2.6 10_06_0038 - 9958520-9958763,9959240-9959394 29 2.6 08_02_0546 - 18474217-18475133,18475207-18475396,18475870-184763... 29 2.6 06_03_0617 + 22773981-22774216,22774715-22774880 29 3.4 05_03_0039 - 7621613-7622695 29 3.4 05_07_0339 - 29375424-29377166,29377272-29377441,29377888-293780... 29 4.5 01_01_0572 - 4244714-4245311,4245694-4245736,4246172-4246283,424... 29 4.5 05_05_0230 - 23476919-23477372,23477656-23477695,23478578-234787... 28 5.9 02_02_0503 + 11008475-11008793,11009983-11010140,11011863-110121... 28 5.9 01_06_1167 - 35062766-35062870,35063165-35063228,35063647-350637... 28 5.9 10_08_0801 + 20670795-20671730 28 7.8 09_06_0245 - 21833622-21833901,21833988-21834059,21834152-218342... 28 7.8 06_03_1348 - 29497084-29497384,29497464-29497634,29497717-294985... 28 7.8 06_01_1148 + 9629630-9629759,9629848-9630581,9630660-9631121,963... 28 7.8 06_01_1032 + 8055678-8055782,8055875-8055936,8057302-8057507,805... 28 7.8 05_07_0218 + 28470325-28470454,28470543-28471276,28471355-284718... 28 7.8 05_02_0043 + 5964749-5966406,5966725-5966791,5967174-5967329,596... 28 7.8 02_05_0268 - 27302734-27303034,27303114-27303284,27303367-273041... 28 7.8 02_02_0307 - 8809724-8811589,8811681-8811762,8812130-8812242,881... 28 7.8 01_06_1803 + 39985439-39985701,39986582-39987971 28 7.8 01_02_0132 + 11444480-11444609,11444698-11445131,11445210-114454... 28 7.8 >10_08_1037 - 22477358-22478752 Length = 464 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/64 (31%), Positives = 28/64 (43%) Frame = +1 Query: 85 EDLLELRSQAGSLAESVESLGPAPKNKAPENPHQQHASPTKTKPNHSFLPKPSELREMNF 264 E+ L + G+ A + + A +AP PH H P P+ LP PS +N Sbjct: 333 ENSLFSATPPGAAAAAAAAAAAATGQQAP--PHHPHPPPPPPVPSPGILPSPSGF--LNL 388 Query: 265 WSPT 276 SPT Sbjct: 389 LSPT 392 >05_05_0010 - 21496089-21496487 Length = 132 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +3 Query: 108 ASGQLGGVSGEPRSGSEEQSTRESPPAARVSNENKTES 221 +SG +GG S PR S S+ SPP++ VS+E E+ Sbjct: 29 SSGVVGG-SSSPRRLSSSSSSTASPPSSCVSSEGSPEA 65 >12_02_0953 - 24736642-24736673,24737104-24737188,24737267-24737386, 24737484-24737549,24737629-24737799,24737901-24737999, 24738075-24738186,24738282-24738343,24738412-24738483, 24738583-24738681,24738764-24738997,24739104-24739178, 24739299-24739386,24739478-24739638,24739734-24739841, 24739934-24741922,24742007-24742279,24742957-24743295, 24743449-24745038,24745166-24745241,24745333-24745412, 24745614-24745679,24745761-24745830,24745899-24746134, 24746149-24746319,24746915-24747097,24747176-24747241, 24747326-24747389,24747472-24747530,24747612-24747699, 24747799-24747891,24747956-24748116,24748215-24748307, 24748405-24748518,24748654-24748773,24748852-24748935, 24749016-24749171,24749518-24750154,24752874-24752929 Length = 2815 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/33 (51%), Positives = 21/33 (63%) Frame = +1 Query: 46 KKELATSTSTLAEEDLLELRSQAGSLAESVESL 144 K EL + L+EE+L LRS GSL S+ESL Sbjct: 1938 KDELMENLHVLSEENL-NLRSVVGSLESSIESL 1969 >10_06_0038 - 9958520-9958763,9959240-9959394 Length = 132 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -2 Query: 257 ISRNSDGFGRKE*FGFVFVGDACCWWGFSGALFFGAGPRLSTDSAKLPACD 105 +SR++ F R V G C WW S ++ G +L D+ + CD Sbjct: 78 VSRHATRFPRWLGGAMVLSGGVCWWWSMSASV--GGPQQLHDDNVRYGGCD 126 >08_02_0546 - 18474217-18475133,18475207-18475396,18475870-18476313, 18476629-18477495,18478858-18479367 Length = 975 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 55 LATSTSTLAEEDLLELRSQAGSLAESVESLGPAPKNKAPENPH 183 L T T TL E + GS A+S + P P + +P NP+ Sbjct: 905 LRTDTGTLIERFKQAISESCGSTAKSGFPMPPVPAHWSPSNPN 947 >06_03_0617 + 22773981-22774216,22774715-22774880 Length = 133 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -3 Query: 157 SEPDRGSPLTPPSCPLAIS 101 S P G PL PPS PLA+S Sbjct: 2 SMPSAGPPLLPPSLPLAVS 20 >05_03_0039 - 7621613-7622695 Length = 360 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = +1 Query: 100 LRSQAGSLAESVESLGPAPKNKAPENPHQQHASPTKTKPNHSFLPKP 240 + Q ++ E L P PK K PH +H S + KP PKP Sbjct: 42 MSKQGRAMYEKPPELEPKPKPK--PKPHPKHESKPEPKPEPKPEPKP 86 >05_07_0339 - 29375424-29377166,29377272-29377441,29377888-29378030, 29378363-29378478,29378576-29378814,29378909-29379110, 29379212-29379430,29379657-29379724,29379806-29379812, 29380404-29380616 Length = 1039 Score = 28.7 bits (61), Expect = 4.5 Identities = 20/67 (29%), Positives = 29/67 (43%) Frame = +1 Query: 7 SNRSWLSIALLGFKKELATSTSTLAEEDLLELRSQAGSLAESVESLGPAPKNKAPENPHQ 186 + RSWL L K + E + R++ GS + S + K K PEN H Sbjct: 961 TERSWLG-QLREMAKASFSKEGQGGEAEASGSRAKGGSRSMSSVASSSDSKAKGPENSHS 1019 Query: 187 QHASPTK 207 Q +S +K Sbjct: 1020 QWSSKSK 1026 >01_01_0572 - 4244714-4245311,4245694-4245736,4246172-4246283, 4246462-4246551,4246625-4246787,4246909-4247015, 4247149-4247230,4247314-4247351,4247434-4247542, 4248031-4248095,4248358-4248468,4248610-4248747 Length = 551 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 157 SEPDRGSPLTPPSCPLAISVPTSLLQLTWKL 65 + P SP+ PP+ P A P LL+ +W+L Sbjct: 8 ARPPASSPVDPPASPPAPEDPCVLLRRSWEL 38 >05_05_0230 - 23476919-23477372,23477656-23477695,23478578-23478700, 23479114-23479151,23479289-23479674,23479875-23481053, 23481805-23481928,23482733-23482779 Length = 796 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/61 (27%), Positives = 27/61 (44%) Frame = +1 Query: 37 LGFKKELATSTSTLAEEDLLELRSQAGSLAESVESLGPAPKNKAPENPHQQHASPTKTKP 216 +G +++ TS++ R+ A S A S P P+ +AP P P +T P Sbjct: 281 VGRSSSISSLTSSINRPAANGGRNSAPSSAPSSRPSSPGPRPRAPVRPLDIPDFPNETPP 340 Query: 217 N 219 N Sbjct: 341 N 341 >02_02_0503 + 11008475-11008793,11009983-11010140,11011863-11012102, 11013502-11013757,11013846-11014057,11014413-11014453, 11014531-11014567 Length = 420 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 218 FGFVFVGDACCWWGFSGALFFGAGPRLSTDSA 123 +GF+ DACC G G LF P+++ A Sbjct: 324 YGFLTTTDACCGLGKYGGLFMCVLPQMACSDA 355 >01_06_1167 - 35062766-35062870,35063165-35063228,35063647-35063738, 35064137-35064205,35064322-35064412,35064509-35064732, 35065064-35065180,35065583-35065651,35066172-35066237, 35066335-35066505,35066581-35066661,35067620-35067700 Length = 409 Score = 28.3 bits (60), Expect = 5.9 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +1 Query: 103 RSQAGSLAESVESLGPAPKNKAPENPHQQHASPTKTKPN 219 + G +V+S AP+NKAPEN A+PT K N Sbjct: 177 QKNVGKSDANVDSKKAAPENKAPEN----KANPTPAKNN 211 >10_08_0801 + 20670795-20671730 Length = 311 Score = 27.9 bits (59), Expect = 7.8 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +1 Query: 58 ATSTSTLAEEDLLELRSQAGSLAESVESLGPAPKNKAPENPHQQHASP 201 A + S++A + + AES S P+P+ P +P + ASP Sbjct: 194 AAAASSVAAAAAAVFAGVSSASAESAASAAPSPRTPTPYSPARTPASP 241 >09_06_0245 - 21833622-21833901,21833988-21834059,21834152-21834231, 21834366-21835109,21835212-21835547 Length = 503 Score = 27.9 bits (59), Expect = 7.8 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +3 Query: 93 VGTEIASGQLGGVSGEPRSGSEEQSTRESPPAARVSNENKTESFLPP 233 VG A+ S E R+ PPAA S++ K ++F+PP Sbjct: 150 VGDGGAASAAAPASSSSMEEWSEIDLRDPPPAAAASDKPKHKAFVPP 196 >06_03_1348 - 29497084-29497384,29497464-29497634,29497717-29498549, 29498631-29499092,29499171-29499904,29499993-29500122 Length = 876 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 178 DSRVLCSSEPDRGSPLTPPSCPLAISVP 95 D V + P R + LTPP C L+I P Sbjct: 526 DIVVKMTPHPSRPTELTPPKCKLSIEAP 553 >06_01_1148 + 9629630-9629759,9629848-9630581,9630660-9631121, 9631203-9632035,9632118-9632288,9632368-9632668 Length = 876 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 178 DSRVLCSSEPDRGSPLTPPSCPLAISVP 95 D V + P R + LTPP C L+I P Sbjct: 526 DIVVKMTPRPSRPTELTPPKCKLSIEAP 553 >06_01_1032 + 8055678-8055782,8055875-8055936,8057302-8057507, 8057595-8058314,8058404-8058603,8058988-8059172, 8059287-8059354,8059432-8060246,8060502-8060599, 8060702-8060887,8061358-8061538,8061651-8061812, 8061894-8061937,8062059-8062115,8062409-8062505, 8062614-8062786,8062868-8063081,8063270-8063395, 8064072-8064188,8064459-8064566,8064729-8064898, 8065049-8065127,8065211-8065285,8065845-8065942, 8066030-8066137,8066238-8066295,8066527-8066631, 8067461-8069516,8069804-8070697,8070896-8071852, 8072022-8072075,8072157-8072222,8072294-8073472, 8073868-8075598,8075764-8075829,8076763-8077788, 8077893-8078041 Length = 4264 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +1 Query: 79 AEEDLLELRSQAGSLAESVESLGPAPKNKAPENPHQQHASPTKTKPN 219 ++ED +E+ Q ++ S P A N +HA+PT+ N Sbjct: 3555 SKEDNMEVEDQFDGISRGPSSFSPDTLESAELNQAAEHAAPTEDDGN 3601 >05_07_0218 + 28470325-28470454,28470543-28471276,28471355-28471816, 28471898-28472730,28472813-28472983,28473063-28473180 Length = 815 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 178 DSRVLCSSEPDRGSPLTPPSCPLAISVP 95 D V + P R + LTPP C L+I P Sbjct: 526 DIVVKMTPRPSRPTELTPPKCKLSIEAP 553 >05_02_0043 + 5964749-5966406,5966725-5966791,5967174-5967329, 5967782-5967865,5968020-5968073 Length = 672 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/50 (24%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = -3 Query: 430 LNQIRTTALPFALLPRDRNP---YTVSTFSTTKSYTGEYLEQTQRVSLWY 290 +N+ + +A+ L DR+ Y++S + +G+Y + +Q++ WY Sbjct: 187 VNKGKQSAMKNTQLDHDRHSMEEYSISDIELSSEISGQYQDPSQQIGQWY 236 >02_05_0268 - 27302734-27303034,27303114-27303284,27303367-27304199, 27304281-27304742,27304821-27305554,27305643-27305772 Length = 876 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 178 DSRVLCSSEPDRGSPLTPPSCPLAISVP 95 D V + P R + LTPP C L+I P Sbjct: 526 DIVVKMTPRPSRPTELTPPKCKLSIEAP 553 >02_02_0307 - 8809724-8811589,8811681-8811762,8812130-8812242, 8812361-8812492,8812681-8812864,8813002-8813135, 8813552-8813656,8813738-8813839,8813930-8814022, 8814136-8814456,8814595-8814696,8814791-8814853, 8815213-8815708,8815964-8816124,8816213-8816743, 8817077-8817118,8817203-8817334,8817639-8817703, 8817858-8818169,8818262-8818334,8818425-8818517, 8819440-8819501,8819740-8819809 Length = 1777 Score = 27.9 bits (59), Expect = 7.8 Identities = 20/66 (30%), Positives = 29/66 (43%) Frame = +1 Query: 49 KELATSTSTLAEEDLLELRSQAGSLAESVESLGPAPKNKAPENPHQQHASPTKTKPNHSF 228 K S+ L E + R + AE V +P N P +P+ ASP T+ + Sbjct: 1613 KSALPSSEGLTEANTFATRVMNPNAAEFVPGQSRSP-NGNPASPNGPLASPGGTEASPHG 1671 Query: 229 LPKPSE 246 LP PS+ Sbjct: 1672 LPSPSD 1677 >01_06_1803 + 39985439-39985701,39986582-39987971 Length = 550 Score = 27.9 bits (59), Expect = 7.8 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 107 RKRAAWRSQWRASVRLRRTKHPRIPTSSTRLQRKQNRIIPSSRNH 241 R++ RSQ + V RR PR+ T RKQ+ ++P ++H Sbjct: 459 REKHVGRSQ--SCVTYRRWSSPRMSTIQNGTLRKQHTLVPVRKSH 501 >01_02_0132 + 11444480-11444609,11444698-11445131,11445210-11445431, 11445510-11445971,11446053-11446885,11446968-11447138, 11447218-11447518 Length = 850 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 178 DSRVLCSSEPDRGSPLTPPSCPLAISVP 95 D V + P R + LTPP C L+I P Sbjct: 500 DIVVKMTPRPSRPTELTPPKCKLSIEAP 527 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,699,983 Number of Sequences: 37544 Number of extensions: 374307 Number of successful extensions: 1517 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1516 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -