BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0991 (743 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB8E5.09 |||AAA family ATPase Rvb1 |Schizosaccharomyces pombe... 26 4.9 SPBC3B9.16c |nup120||nucleoporin Nup120|Schizosaccharomyces pomb... 26 4.9 SPAPB8E5.07c |||ribosome biogenesis protein Rrp12|Schizosaccharo... 26 6.5 SPBP4H10.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 25 8.6 SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gc... 25 8.6 >SPAPB8E5.09 |||AAA family ATPase Rvb1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 456 Score = 26.2 bits (55), Expect = 4.9 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = -1 Query: 380 FTFINVRISNTLMSVTVYLSIREYCAVR 297 FT++N + +T+ + ++ S R C +R Sbjct: 313 FTYLNQALESTISPIVIFASNRGICTIR 340 >SPBC3B9.16c |nup120||nucleoporin Nup120|Schizosaccharomyces pombe|chr 2|||Manual Length = 1136 Score = 26.2 bits (55), Expect = 4.9 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 8/51 (15%) Frame = +1 Query: 508 VLQFLNENWRVVTEEFGQPVVDYA---LNV-----TVNTAKKFFDAVPYDE 636 ++ FL EN ++ E+F + VD LN +VNTA +FF A+ Y E Sbjct: 730 LVSFLLENSALLLEKFEEEDVDSTNCNLNTMEALASVNTALQFFSALNYSE 780 >SPAPB8E5.07c |||ribosome biogenesis protein Rrp12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1163 Score = 25.8 bits (54), Expect = 6.5 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +1 Query: 511 LQFLNENWRVVTEEFG-QPVVDYALNVTVNTAKKFFDAVPYDELLNVPI 654 L+F + V+ E+ + V+ +L V T K D +P D++++VP+ Sbjct: 536 LEFASILVNVLYEQVSLRSVICNSLTALVETNSKVADKLPLDDVISVPV 584 >SPBP4H10.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 308 Score = 25.4 bits (53), Expect = 8.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 238 AHSPPDIKCLLEPIDIYNVNAPPTLR 161 A PP IK P+DI N++A L+ Sbjct: 224 ASQPPSIKTDASPVDIKNMDAAEKLK 249 >SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gcn2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1576 Score = 25.4 bits (53), Expect = 8.6 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +2 Query: 137 YTETLELISQG-GWRIYVVDVYGLQ*TLNIRWAVSSTTHISNKKKIKENIL 286 Y LE ++G GWR+YV+ Y + TL T + + NIL Sbjct: 309 YEYQLERETRGYGWRLYVLQEYSPKFTLFSLLQTVLTLDVETVRAFSNNIL 359 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,845,857 Number of Sequences: 5004 Number of extensions: 54400 Number of successful extensions: 112 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -