BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0989 (694 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 25 0.90 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 25 0.90 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 2.8 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 23 2.8 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 23 3.6 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 23 3.6 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 23 3.6 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 23 3.6 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 23 3.6 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 3.6 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 3.6 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 23 3.6 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 23 3.6 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 23 3.6 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 23 3.6 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 23 3.6 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 23 3.6 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 22 4.8 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 22 4.8 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 22 4.8 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 22 4.8 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 22 4.8 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 22 4.8 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 22 4.8 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 22 4.8 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 22 4.8 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 22 4.8 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 4.8 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 4.8 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 22 6.4 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 22 6.4 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 22 6.4 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 6.4 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 8.4 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 24.6 bits (51), Expect = 0.90 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +1 Query: 310 SKAKLIDR*KRILTRNYKCMKRRPDETKERNKNYIEIFNSLSPKIY 447 SK + DR +R +R K + ++T N NY +N+ K+Y Sbjct: 63 SKERSRDRTERERSREPKIISSLSNKTIHNNNNYKYNYNNNCKKLY 108 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 24.6 bits (51), Expect = 0.90 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +1 Query: 292 KINEKKSKAKLIDR*KRILTRNYK---CMKRRPDETKERNKNYIEIFNSLSPKI 444 K+ E+++ K R + R+YK ++ + +KER+++ IE S PKI Sbjct: 261 KLLEERTSRKRYSRSREREQRSYKNENSYRKYRETSKERSRDRIERERSREPKI 314 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 168 FAVLIVCMLKTKEVEETLKI*NSTLQDKIKIG 263 FA L + +K K++EE LKI D + G Sbjct: 140 FANLGIQCVKKKDIEEALKIREEIRVDPFRTG 171 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 168 FAVLIVCMLKTKEVEETLKI*NSTLQDKIKIG 263 FA L + +K K++EE LKI D + G Sbjct: 140 FANLGIQCVKKKDIEEALKIREEIRVDPFRTG 171 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 3.6 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +1 Query: 292 KINEKKSKAKLIDR*KRILTRNYKCMK--RRPDET-KERNKNYIEIFNSLSPKI 444 K+ E+++ K R + + YK + R+ ET KER++N E S PKI Sbjct: 28 KLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKERSRNRTEREKSKEPKI 81 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 3.6 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +1 Query: 292 KINEKKSKAKLIDR*KRILTRNYKCMK--RRPDET-KERNKNYIEIFNSLSPKI 444 K+ E+++ K R + + YK + R+ ET KER++N E S PKI Sbjct: 28 KLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKERSRNRTEREKSKEPKI 81 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 3.6 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +1 Query: 292 KINEKKSKAKLIDR*KRILTRNYKCMK--RRPDET-KERNKNYIEIFNSLSPKI 444 K+ E+++ K R + + YK + R+ ET KER++N E S PKI Sbjct: 28 KLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKERSRNRTEREKSKEPKI 81 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 22.6 bits (46), Expect = 3.6 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +1 Query: 292 KINEKKSKAKLIDR*KRILTRNYKCMK--RRPDET-KERNKNYIEIFNSLSPKI 444 K+ E+++ K R + + YK + R+ ET KER++N E S PKI Sbjct: 28 KLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKERSRNRTEREKSKEPKI 81 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 Query: 364 CMKRRPDETKERNKNYIEIFN 426 C K R E KE+++ Y +++N Sbjct: 4 CSKDRNREYKEKDRRYEKLYN 24 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.6 bits (46), Expect = 3.6 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 79 K*NHIVCAPSCAYCVT*CEGPGSSS 5 K H+V + C +C GPGSSS Sbjct: 3 KGRHVVMS-CCCWCCDNLGGPGSSS 26 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.6 bits (46), Expect = 3.6 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +1 Query: 292 KINEKKSKAKLIDR*KRILTRNYKCMK--RRPDET-KERNKNYIEIFNSLSPKI 444 K+ E+++ K R + + YK + R+ ET KER++N E S PKI Sbjct: 261 KLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKERSRNRTEREKSKEPKI 314 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 3.6 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +1 Query: 292 KINEKKSKAKLIDR*KRILTRNYKCMK--RRPDET-KERNKNYIEIFNSLSPKI 444 K+ E+++ K R + + YK + R+ ET KER++N E S PKI Sbjct: 261 KLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKERSRNRTEREKSKEPKI 314 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 3.6 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +1 Query: 292 KINEKKSKAKLIDR*KRILTRNYKCMK--RRPDET-KERNKNYIEIFNSLSPKI 444 K+ E+++ K R + + YK + R+ ET KER++N E S PKI Sbjct: 261 KLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKERSRNRTEREKSKEPKI 314 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 3.6 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +1 Query: 292 KINEKKSKAKLIDR*KRILTRNYKCMK--RRPDET-KERNKNYIEIFNSLSPKI 444 K+ E+++ K R + + YK + R+ ET KER++N E S PKI Sbjct: 261 KLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKERSRNRTEREKSKEPKI 314 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 3.6 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +1 Query: 292 KINEKKSKAKLIDR*KRILTRNYKCMK--RRPDET-KERNKNYIEIFNSLSPKI 444 K+ E+++ K R + + YK + R+ ET KER++N E S PKI Sbjct: 261 KLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKERSRNRTEREKSKEPKI 314 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.6 bits (46), Expect = 3.6 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +1 Query: 292 KINEKKSKAKLIDR*KRILTRNYKCMK--RRPDET-KERNKNYIEIFNSLSPKI 444 K+ E+++ K R + + YK + R+ ET KER++N E S PKI Sbjct: 250 KLLEERTSCKRYSRSREREQKLYKNEREYRKYGETSKERSRNRTEREKSKEPKI 303 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 22.6 bits (46), Expect = 3.6 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = +1 Query: 310 SKAKLIDR*KRILTRNYKCMKRRPDETKERNKNYIEIFNSLSPKIY 447 SK + DR +R ++ K + + N NY +N+ + K+Y Sbjct: 296 SKERSRDRTERERSKERKIISSLSNNYNYNNNNYKYNYNNYNKKLY 341 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 346 LTRNYKCMKRRPDETKERNKNYIEIFNSLSPKI 444 L +N + ++ + +KER++N E S PKI Sbjct: 49 LYKNKREYRKYRETSKERSRNRTERERSKEPKI 81 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 346 LTRNYKCMKRRPDETKERNKNYIEIFNSLSPKI 444 L +N + ++ + +KER++N E S PKI Sbjct: 49 LYKNKREYRKYRETSKERSRNRTERERSKEPKI 81 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 346 LTRNYKCMKRRPDETKERNKNYIEIFNSLSPKI 444 L +N + ++ + +KER++N E S PKI Sbjct: 49 LYKNKREYRKYRETSKERSRNRTERERSKEPKI 81 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 346 LTRNYKCMKRRPDETKERNKNYIEIFNSLSPKI 444 L +N + ++ + +KER++N E S PKI Sbjct: 49 LYKNKREYRKYRETSKERSRNRTERERSKEPKI 81 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 346 LTRNYKCMKRRPDETKERNKNYIEIFNSLSPKI 444 L +N + ++ + +KER++N E S PKI Sbjct: 49 LYKNKREYRKYRETSKERSRNRTERERSKEPKI 81 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 346 LTRNYKCMKRRPDETKERNKNYIEIFNSLSPKI 444 L +N + ++ + +KER++N E S PKI Sbjct: 49 LYKNKREYRKYRETSKERSRNRTERERSKEPKI 81 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 346 LTRNYKCMKRRPDETKERNKNYIEIFNSLSPKI 444 L +N + ++ + +KER++N E S PKI Sbjct: 49 LYKNKREYRKYRETSKERSRNRTERERSKEPKI 81 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 346 LTRNYKCMKRRPDETKERNKNYIEIFNSLSPKI 444 L +N + ++ + +KER++N E S PKI Sbjct: 49 LYKNKREYRKYRETSKERSRNRTERERSKEPKI 81 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 346 LTRNYKCMKRRPDETKERNKNYIEIFNSLSPKI 444 L +N + ++ + +KER++N E S PKI Sbjct: 49 LYKNKREYRKYRETSKERSRNRTERERSKEPKI 81 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 346 LTRNYKCMKRRPDETKERNKNYIEIFNSLSPKI 444 L +N + ++ + +KER++N E S PKI Sbjct: 49 LYKNKREYRKYRETSKERSRNRTERERSKEPKI 81 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 346 LTRNYKCMKRRPDETKERNKNYIEIFNSLSPKI 444 L +N + ++ + +KER++N E S PKI Sbjct: 282 LYKNKREYRKYRETSKERSRNRTERERSKEPKI 314 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 346 LTRNYKCMKRRPDETKERNKNYIEIFNSLSPKI 444 L +N + ++ + +KER++N E S PKI Sbjct: 282 LYKNKREYRKYRETSKERSRNRTERERSKEPKI 314 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = +1 Query: 310 SKAKLIDR*KRILTRNYKCMKRRPDETKERNKNYIEIFNSLSPKIY 447 SK + DR +R ++ +K + + N NY +++ + K+Y Sbjct: 63 SKERSRDRKEREKSKEHKIISSLSNNYNYNNNNYKKLYCNNYKKLY 108 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = +1 Query: 310 SKAKLIDR*KRILTRNYKCMKRRPDETKERNKNYIEIFNSLSPKIY 447 SK + DR +R ++ +K + + N NY +++ + K+Y Sbjct: 63 SKERSRDRKEREKSKEHKIISSLSNNYNYNNNNYKKLYCNNYKKLY 108 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 6.4 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +1 Query: 292 KINEKKSKAKLIDR*KRILTRNYKCMK--RRPDET-KERNKNYIEIFNSLSPKI 444 K+ E+++ K R + +YK K R+ ET KER+++ E S PKI Sbjct: 28 KLLEERTSRKRYSRSREREQNSYKNEKEYRKYRETSKERSRDRTERERSREPKI 81 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 6.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 356 FLVRIRFYRSINLALDFFSFILISGLLNIQ 267 +LVR R S+ D + ILI LL +Q Sbjct: 30 YLVRSRTLTSLGDLSDVHTGILIKALLTVQ 59 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = +1 Query: 310 SKAKLIDR*KRILTRNYKCMKRRPDETKERNKNYIEIFNSLSPKIY 447 SK + DR +R ++ +K + + N NY +++ + K+Y Sbjct: 63 SKERSRDRKEREKSKEHKIISSLSNNYNYNNNNYKKLYCNNYRKLY 108 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,208 Number of Sequences: 438 Number of extensions: 3709 Number of successful extensions: 36 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -