Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0985
         (598 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein ...    26   0.32 
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    23   1.7  

>AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein
           protein.
          Length = 352

 Score = 25.8 bits (54), Expect = 0.32
 Identities = 14/43 (32%), Positives = 19/43 (44%)
 Frame = +2

Query: 11  AAHAQASTSHGAWSPGYGGYASDAHYGAPAAGLYKYGPAPLAH 139
           A + Q    HG+   G GGY S +   +P  G   + P P  H
Sbjct: 91  ATYYQHQQDHGSGMDGMGGYRSAS--PSPGMGHMGHTPTPNGH 131


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 23.4 bits (48), Expect = 1.7
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = -2

Query: 396 CCTSGVSTTYWPS 358
           C TS  STT WP+
Sbjct: 771 CATSNYSTTRWPA 783


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 106,081
Number of Sequences: 438
Number of extensions: 1693
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17482179
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)