BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0981 (701 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 26 1.3 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 26 1.3 Z18888-1|CAA79326.1| 258|Anopheles gambiae chymotrypsin 2 protein. 25 3.0 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 25 3.0 AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. 25 3.0 AJ297930-1|CAC35450.1| 104|Anopheles gambiae hypothetical prote... 24 4.0 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 24 4.0 AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 23 7.0 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 23 7.0 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 23 7.0 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 25.8 bits (54), Expect = 1.3 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 517 WPSTCAPRRRATFAAS*HSLSSGPAQTRRRPTPSGPASSRRSC 645 +PS P R+ F S +S A+ RR P+ S P R+C Sbjct: 114 FPSIANPNPRSPFRHLDFS-TSATAELRRNPSLSAPDECARAC 155 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 25.8 bits (54), Expect = 1.3 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 517 WPSTCAPRRRATFAAS*HSLSSGPAQTRRRPTPSGPASSRRSC 645 +PS P R+ F S +S A+ RR P+ S P R+C Sbjct: 114 FPSIANPNPRSPFRHLDFS-TSATAELRRNPSLSAPDECARAC 155 >Z18888-1|CAA79326.1| 258|Anopheles gambiae chymotrypsin 2 protein. Length = 258 Score = 24.6 bits (51), Expect = 3.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -2 Query: 457 LVQRISTRVSSSVPIPSIQRCSSWHRYSSGGVIRATITS 341 LVQ + + +VP+ + R + W R S+ G +R + S Sbjct: 134 LVQSVEY-LEKAVPVNATVRLTGWGRTSTNGNVRTLLQS 171 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 24.6 bits (51), Expect = 3.0 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 96 ILTEMAYQRAPTVVGVPNFNAVEDAAALRAAMKGF 200 I ++MA +AP + G+PN AV+ A L GF Sbjct: 481 IASQMANHKAPGLDGIPN-AAVKTAIMLFPESSGF 514 >AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. Length = 144 Score = 24.6 bits (51), Expect = 3.0 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -3 Query: 432 CLHPCPYPPYNGAALGTDT 376 C H C Y PY GA + T Sbjct: 119 CSHNCIYIPYGGAEVSVPT 137 >AJ297930-1|CAC35450.1| 104|Anopheles gambiae hypothetical protein protein. Length = 104 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 432 CLHPCPYPPYNGAALG 385 C PCP PP + A LG Sbjct: 24 CDEPCPVPPKHYAELG 39 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 24.2 bits (50), Expect = 4.0 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 4/30 (13%) Frame = +3 Query: 72 SIFDTNPRILTEMAYQ----RAPTVVGVPN 149 S+ D PR L ++A+Q +AP + G+PN Sbjct: 423 SVDDVTPRELQDIAHQMATRKAPGLDGIPN 452 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 23.4 bits (48), Expect = 7.0 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -1 Query: 185 GPQSCCIFYSIEVRHSYYS 129 G +S C FYS R YS Sbjct: 196 GEESLCFFYSFVTRSGLYS 214 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 23.4 bits (48), Expect = 7.0 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -1 Query: 185 GPQSCCIFYSIEVRHSYYS 129 G +S C FYS R YS Sbjct: 196 GEESLCFFYSFVTRSGLYS 214 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/27 (44%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = -3 Query: 435 GCLHPC-PYPPYNGAALGTDTPQGESS 358 G HP P P NG + D PQG S+ Sbjct: 68 GRSHPAEPAPGGNGPFVRPDAPQGRSA 94 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 761,846 Number of Sequences: 2352 Number of extensions: 16551 Number of successful extensions: 82 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -