BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0979 (787 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q22GD1 Cluster: EF hand family protein; n=1; Tetrahymen... 34 3.5 UniRef50_Q23E99 Cluster: Putative uncharacterized protein; n=1; ... 34 4.6 >UniRef50_Q22GD1 Cluster: EF hand family protein; n=1; Tetrahymena thermophila SB210|Rep: EF hand family protein - Tetrahymena thermophila SB210 Length = 686 Score = 34.3 bits (75), Expect = 3.5 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -3 Query: 329 NFGICLLFVNTKLQIEGANDRILFKK-KVKLNLIRQKYLCI*HFLFIINSQDEMVKY 162 NF C+L +N QI + +++ + K+K+NL +Q ++CI ++ II ++ Y Sbjct: 40 NFYFCMLSLNDWKQISISQNKLSDRPVKIKINLDKQNFICINNYQAIIKNKQTYKNY 96 >UniRef50_Q23E99 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 762 Score = 33.9 bits (74), Expect = 4.6 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 1/67 (1%) Frame = -3 Query: 350 FVTIMLGNFGICLLFVN-TKLQIEGANDRILFKKKVKLNLIRQKYLCI*HFLFIINSQDE 174 F+T+ LG+F +CLLF+ K + N ++LF++++ N RQ L +F F++ D Sbjct: 42 FITLTLGSF-LCLLFIQYVKQMVYKTNPKVLFEQQIVSNPSRQN-LNPENFSFVMALLDS 99 Query: 173 MVKYLTN 153 +T+ Sbjct: 100 SFNPITD 106 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 641,504,384 Number of Sequences: 1657284 Number of extensions: 11096505 Number of successful extensions: 22582 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22556 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 66673674990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -