BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0979 (787 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF106589-7|AAN73853.1| 843|Caenorhabditis elegans Hypothetical ... 29 5.0 AF106589-6|AAN73852.1| 841|Caenorhabditis elegans Hypothetical ... 29 5.0 >AF106589-7|AAN73853.1| 843|Caenorhabditis elegans Hypothetical protein Y44E3A.6b protein. Length = 843 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 202 KCQIHKYFCRIRFNFTFFLNKILSFAPSICNFV 300 +CQ K RIRF T +NK +S + NFV Sbjct: 329 ECQSWKCLGRIRFETTRAINKFVSISDPAANFV 361 >AF106589-6|AAN73852.1| 841|Caenorhabditis elegans Hypothetical protein Y44E3A.6a protein. Length = 841 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 202 KCQIHKYFCRIRFNFTFFLNKILSFAPSICNFV 300 +CQ K RIRF T +NK +S + NFV Sbjct: 329 ECQSWKCLGRIRFETTRAINKFVSISDPAANFV 361 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,541,704 Number of Sequences: 27780 Number of extensions: 290074 Number of successful extensions: 586 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 586 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1903721438 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -