BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0979 (787 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 24 1.8 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 3.2 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 3.2 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 3.2 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 3.2 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 22 5.6 AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 22 5.6 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 5.6 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 23.8 bits (49), Expect = 1.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 362 MSWIFVTIMLGNFGICLLFVN 300 MSW V + +G FG+ LL N Sbjct: 1 MSWQRVFLAVGLFGVLLLLTN 21 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.0 bits (47), Expect = 3.2 Identities = 10/16 (62%), Positives = 12/16 (75%), Gaps = 1/16 (6%) Frame = -2 Query: 231 PTEIFMYLT-FFIYYK 187 P FM+LT FFI+YK Sbjct: 471 PVAYFMFLTFFFIHYK 486 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.0 bits (47), Expect = 3.2 Identities = 10/16 (62%), Positives = 12/16 (75%), Gaps = 1/16 (6%) Frame = -2 Query: 231 PTEIFMYLT-FFIYYK 187 P FM+LT FFI+YK Sbjct: 457 PVAYFMFLTFFFIHYK 472 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.0 bits (47), Expect = 3.2 Identities = 10/16 (62%), Positives = 12/16 (75%), Gaps = 1/16 (6%) Frame = -2 Query: 231 PTEIFMYLT-FFIYYK 187 P FM+LT FFI+YK Sbjct: 491 PVAYFMFLTFFFIHYK 506 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.0 bits (47), Expect = 3.2 Identities = 10/16 (62%), Positives = 12/16 (75%), Gaps = 1/16 (6%) Frame = -2 Query: 231 PTEIFMYLT-FFIYYK 187 P FM+LT FFI+YK Sbjct: 440 PVAYFMFLTFFFIHYK 455 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 22.2 bits (45), Expect = 5.6 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -3 Query: 353 IFVTIMLGNFGICLLFVNTKLQIEGANDRILFKKKV 246 IFVT ++GN C++ K + A + LF V Sbjct: 63 IFVTGLVGNVSTCVVIARNK-SMHTATNYYLFSLAV 97 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 22.2 bits (45), Expect = 5.6 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 665 SISSNSIQYIFGRVIILHRVSKKKGGIFFVVVMITSVPKTI 787 S SSN I FG II ++K + M+T +P+T+ Sbjct: 78 SHSSNGIHTGFGGSIITIPPTRKLPPLHPHTAMVTHLPQTL 118 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 5.6 Identities = 16/64 (25%), Positives = 27/64 (42%) Frame = +1 Query: 124 NILSKSTEKRLVRYLTISS*EFIINKKCQIHKYFCRIRFNFTFFLNKILSFAPSICNFVL 303 N++S S RL ++ +NK C IH+ + + F + + S C V Sbjct: 1660 NVISDSESGRLDTEMSTWGYHHNVNKHCTIHRTQVKETDDKICFTMRPVVSCASGCTAVE 1719 Query: 304 TNNK 315 T +K Sbjct: 1720 TKSK 1723 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,727 Number of Sequences: 438 Number of extensions: 3392 Number of successful extensions: 14 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -