BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0978 (791 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 60 2e-11 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 27 0.20 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 23 4.3 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 5.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 7.5 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 9.9 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 60.5 bits (140), Expect = 2e-11 Identities = 43/161 (26%), Positives = 85/161 (52%), Gaps = 1/161 (0%) Frame = +1 Query: 112 LITGANSGIGLETAKALVKRKARVIFACRDIAKAKEVIAAIREEQPNGGEMIPMQLDLSS 291 L+TGANSGIG + LV + +VI + K K ++ ++ + G+++P+Q DLS+ Sbjct: 11 LVTGANSGIGKCLIECLVGKGMKVIGIAPQVDKMKTLVEELKSKP---GKLVPLQCDLSN 67 Query: 292 FESIENFVDIIKAGFHKIDVLINNAGVVVPLN-QDEKTKEGFEIHFGVNHLGHFYLTNLL 468 I ++ ++ ID+LINNA + + + Q+++ + +I F +N LG + + Sbjct: 68 QNDILKVIEWVEKNLGAIDILINNATINIDVTLQNDEVLDWKKI-FDINLLGLTCMIQEV 126 Query: 469 LDHLKRATPSRIVIVSSTLHEKGKIDFDDLNLRSEIELAKK 591 L +K+ + +IV+ +++ ++ +N LA K Sbjct: 127 LKLMKKKGINNGIIVN--INDASGLNLLPMNRNRPAYLASK 165 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 27.1 bits (57), Expect = 0.20 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = -2 Query: 130 CLHRLSERFCLSDMYY*YICPNFWISVYVLIQSP 29 C++ S C++ + Y+CP +S + L+ SP Sbjct: 185 CIYVQSINLCMAGRLFGYLCPGMALSQFDLMGSP 218 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.6 bits (46), Expect = 4.3 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 637 MNAYFMRSLAAKLRNSGVD 693 M++YF S LRN GV+ Sbjct: 1 MSSYFANSYIPDLRNGGVE 19 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 22.2 bits (45), Expect = 5.7 Identities = 20/69 (28%), Positives = 34/69 (49%) Frame = +1 Query: 217 EVIAAIREEQPNGGEMIPMQLDLSSFESIENFVDIIKAGFHKIDVLINNAGVVVPLNQDE 396 + I + E Q N ++ ++L S + + FV + AGF ++NA + LNQD Sbjct: 269 DFINMLMELQKNPQKLENIKLT-DSLIAAQAFVFFL-AGFETSSTTMSNALYELALNQDV 326 Query: 397 KTKEGFEIH 423 + K EI+ Sbjct: 327 QKKLREEIN 335 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 7.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 248 GCSSRIAAITSFAFAMSLHAKITRAFLLTKA 156 GCSS+ TS AFA + LL +A Sbjct: 894 GCSSKNGEPTSAAFAQGFATAASSPGLLERA 924 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.4 bits (43), Expect = 9.9 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +2 Query: 137 SDLKQLKPWLKEKPALSLHAETLQRRKKLLPQYERN 244 ++ + KPWL + +S + RK + P + N Sbjct: 113 TEYRFFKPWLGDGLLISTGQKWRNHRKLIAPTFHLN 148 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 228,629 Number of Sequences: 438 Number of extensions: 5396 Number of successful extensions: 15 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -