BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0977 (783 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 87 4e-19 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 26 1.1 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 25 2.6 AY745227-1|AAU93494.1| 99|Anopheles gambiae cytochrome P450 pr... 23 8.1 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 87.4 bits (207), Expect = 4e-19 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +1 Query: 643 AVGTVPAYFNDAQRQATKDAGTISGLNVMRIINEPTAAAIAYGLDK 780 AV TVPAYFND+QRQATKDAG I+GLNVMRIINEPTAAA+AYGLDK Sbjct: 2 AVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDK 47 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 26.2 bits (55), Expect = 1.1 Identities = 9/29 (31%), Positives = 13/29 (44%) Frame = -3 Query: 280 CRHRHMSKWYPNRYRLLCRCPYLSPSCRR 194 C +R +WY + CPY + C R Sbjct: 302 CYYRFRLEWYRTLSKACYNCPYNATDCER 330 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 25.0 bits (52), Expect = 2.6 Identities = 14/59 (23%), Positives = 28/59 (47%) Frame = -1 Query: 573 FFRSKHFVAL*SLYLNMRFAVLFNDLEGEELNIMLYSLVTPFTTNQTLGIKDSVFRVGS 397 FF ++ + L L+ +M ++ND+ + +NI + + T+ + KD GS Sbjct: 446 FFGGRYIILLMGLF-SMYTGFVYNDIFSKSMNIFGSAWSVNYNTSTVMTNKDLTLNPGS 503 >AY745227-1|AAU93494.1| 99|Anopheles gambiae cytochrome P450 protein. Length = 99 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -2 Query: 272 PTHE*VVPKSIPITVPM 222 P H+ V+P +PI +P+ Sbjct: 32 PLHDYVIPNGMPIMIPI 48 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 786,974 Number of Sequences: 2352 Number of extensions: 15731 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81913191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -