BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0972 (714 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharom... 29 0.87 SPAC23H3.15c ||SPAC25H1.01c|sequence orphan|Schizosaccharomyces ... 27 3.5 >SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharomyces pombe|chr 2|||Manual Length = 1016 Score = 28.7 bits (61), Expect = 0.87 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -2 Query: 596 RCSLLYVRNHQAQRGSSYHVRHHHRGSRAGSCGHQ 492 R + +Y Q+ SS+H HHH+ S++ S H+ Sbjct: 538 RTTKIYKAQQHKQK-SSHHKHHHHKKSKSSSSKHK 571 >SPAC23H3.15c ||SPAC25H1.01c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 325 Score = 26.6 bits (56), Expect = 3.5 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +2 Query: 458 YDYAYSVADPHTGDHKSQHESRDGGAVHGSYSLVEPDGSVRKVDYTADDH 607 YDY+ S + H G H ++H GG+ + + G+V Y+ + + Sbjct: 200 YDYSSSGSHTHGGSHGTEHR---GGSYGNDNTANKTRGAVSSAGYSGEGY 246 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,424,347 Number of Sequences: 5004 Number of extensions: 43514 Number of successful extensions: 80 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 333194204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -