BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0972 (714 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 74 5e-15 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 74 5e-15 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 74 5e-15 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 74 5e-15 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 74 5e-15 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 74 5e-15 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 74 5e-15 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 74 5e-15 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 74 5e-15 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 74 5e-15 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 74 5e-15 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 73 7e-15 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 73 1e-14 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 66 8e-13 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 25 1.8 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 25 3.1 AF269154-1|AAF91399.1| 76|Anopheles gambiae transcription fact... 24 4.1 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 5.4 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 5.4 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 7.2 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 9.5 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 23 9.5 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 73.7 bits (173), Expect = 5e-15 Identities = 38/72 (52%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = +2 Query: 404 KFICQPY*CLMFVQAHP--KYDYAYSVADPHTGDHKSQHESRDGGAVHGSYSLVEPDGSV 577 K I QP + V+ H Y+++YSV D HTGD KSQHE+R G VHG YSL++ DG Sbjct: 73 KTIAQPT-IIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQ 131 Query: 578 RKVDYTADDHHG 613 R VDY AD H G Sbjct: 132 RIVDYHADHHTG 143 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 73.7 bits (173), Expect = 5e-15 Identities = 38/72 (52%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = +2 Query: 404 KFICQPY*CLMFVQAHP--KYDYAYSVADPHTGDHKSQHESRDGGAVHGSYSLVEPDGSV 577 K I QP + V+ H Y+++YSV D HTGD KSQHE+R G VHG YSL++ DG Sbjct: 65 KTIAQPT-IIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQ 123 Query: 578 RKVDYTADDHHG 613 R VDY AD H G Sbjct: 124 RIVDYHADHHTG 135 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 73.7 bits (173), Expect = 5e-15 Identities = 38/72 (52%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = +2 Query: 404 KFICQPY*CLMFVQAHP--KYDYAYSVADPHTGDHKSQHESRDGGAVHGSYSLVEPDGSV 577 K I QP + V+ H Y+++YSV D HTGD KSQHE+R G VHG YSL++ DG Sbjct: 65 KTIAQPT-IIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQ 123 Query: 578 RKVDYTADDHHG 613 R VDY AD H G Sbjct: 124 RIVDYHADHHTG 135 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 73.7 bits (173), Expect = 5e-15 Identities = 38/72 (52%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = +2 Query: 404 KFICQPY*CLMFVQAHP--KYDYAYSVADPHTGDHKSQHESRDGGAVHGSYSLVEPDGSV 577 K I QP + V+ H Y+++YSV D HTGD KSQHE+R G VHG YSL++ DG Sbjct: 65 KTIAQPT-IIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQ 123 Query: 578 RKVDYTADDHHG 613 R VDY AD H G Sbjct: 124 RIVDYHADHHTG 135 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 73.7 bits (173), Expect = 5e-15 Identities = 38/72 (52%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = +2 Query: 404 KFICQPY*CLMFVQAHP--KYDYAYSVADPHTGDHKSQHESRDGGAVHGSYSLVEPDGSV 577 K I QP + V+ H Y+++YSV D HTGD KSQHE+R G VHG YSL++ DG Sbjct: 65 KTIAQPT-IIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQ 123 Query: 578 RKVDYTADDHHG 613 R VDY AD H G Sbjct: 124 RIVDYHADHHTG 135 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 73.7 bits (173), Expect = 5e-15 Identities = 38/72 (52%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = +2 Query: 404 KFICQPY*CLMFVQAHP--KYDYAYSVADPHTGDHKSQHESRDGGAVHGSYSLVEPDGSV 577 K I QP + V+ H Y+++YSV D HTGD KSQHE+R G VHG YSL++ DG Sbjct: 73 KTIAQPT-IIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQ 131 Query: 578 RKVDYTADDHHG 613 R VDY AD H G Sbjct: 132 RIVDYHADHHTG 143 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 73.7 bits (173), Expect = 5e-15 Identities = 38/72 (52%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = +2 Query: 404 KFICQPY*CLMFVQAHP--KYDYAYSVADPHTGDHKSQHESRDGGAVHGSYSLVEPDGSV 577 K I QP + V+ H Y+++YSV D HTGD KSQHE+R G VHG YSL++ DG Sbjct: 97 KTIAQPT-IIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQ 155 Query: 578 RKVDYTADDHHG 613 R VDY AD H G Sbjct: 156 RIVDYHADHHTG 167 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 73.7 bits (173), Expect = 5e-15 Identities = 38/72 (52%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = +2 Query: 404 KFICQPY*CLMFVQAHP--KYDYAYSVADPHTGDHKSQHESRDGGAVHGSYSLVEPDGSV 577 K I QP + V+ H Y+++YSV D HTGD KSQHE+R G VHG YSL++ DG Sbjct: 65 KTIAQPT-IIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQ 123 Query: 578 RKVDYTADDHHG 613 R VDY AD H G Sbjct: 124 RIVDYHADHHTG 135 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 73.7 bits (173), Expect = 5e-15 Identities = 38/72 (52%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = +2 Query: 404 KFICQPY*CLMFVQAHP--KYDYAYSVADPHTGDHKSQHESRDGGAVHGSYSLVEPDGSV 577 K I QP + V+ H Y+++YSV D HTGD KSQHE+R G VHG YSL++ DG Sbjct: 73 KTIAQPT-IIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQ 131 Query: 578 RKVDYTADDHHG 613 R VDY AD H G Sbjct: 132 RIVDYHADHHTG 143 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 73.7 bits (173), Expect = 5e-15 Identities = 38/72 (52%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = +2 Query: 404 KFICQPY*CLMFVQAHP--KYDYAYSVADPHTGDHKSQHESRDGGAVHGSYSLVEPDGSV 577 K I QP + V+ H Y+++YSV D HTGD KSQHE+R G VHG YSL++ DG Sbjct: 65 KTIAQPT-IIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQ 123 Query: 578 RKVDYTADDHHG 613 R VDY AD H G Sbjct: 124 RIVDYHADHHTG 135 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 73.7 bits (173), Expect = 5e-15 Identities = 38/72 (52%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = +2 Query: 404 KFICQPY*CLMFVQAHP--KYDYAYSVADPHTGDHKSQHESRDGGAVHGSYSLVEPDGSV 577 K I QP + V+ H Y+++YSV D HTGD KSQHE+R G VHG YSL++ DG Sbjct: 73 KTIAQPT-IIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQ 131 Query: 578 RKVDYTADDHHG 613 R VDY AD H G Sbjct: 132 RIVDYHADHHTG 143 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 73.3 bits (172), Expect = 7e-15 Identities = 38/72 (52%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = +2 Query: 404 KFICQPY*CLMFVQAHP--KYDYAYSVADPHTGDHKSQHESRDGGAVHGSYSLVEPDGSV 577 K I QP + V+ H Y+++YSV D HTGD KSQHE+R G VHG YSL++ DG Sbjct: 73 KTIAQPT-IIKSVEHHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHH 131 Query: 578 RKVDYTADDHHG 613 R VDY AD H G Sbjct: 132 RIVDYHADHHTG 143 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 72.5 bits (170), Expect = 1e-14 Identities = 37/72 (51%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = +2 Query: 404 KFICQPY*CLMFVQAHP--KYDYAYSVADPHTGDHKSQHESRDGGAVHGSYSLVEPDGSV 577 K I QP + V+ H Y+++YSV D HTGD K+QHE+R G VHG YSL++ DG Sbjct: 65 KTIAQPT-IIKSVEHHAPANYEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQ 123 Query: 578 RKVDYTADDHHG 613 R VDY AD H G Sbjct: 124 RIVDYHADHHTG 135 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 66.5 bits (155), Expect = 8e-13 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +2 Query: 491 TGDHKSQHESRDGGAVHGSYSLVEPDGSVRKVDYTADDHHG 613 TGD KSQ ESRDG V GSYS+V+PDG+ R VDYTAD H+G Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNG 74 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.4 bits (53), Expect = 1.8 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -2 Query: 554 GSSYHVRHHHRGSRAGSCGHQCEGQPRSKH 465 G +H+ HHH G+ A + H + H Sbjct: 704 GGGHHLSHHHGGAAAATGHHHHQHHAAPHH 733 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 24.6 bits (51), Expect = 3.1 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -2 Query: 581 YVRNHQAQRGSSYHVRHHH 525 ++ NH++ G +H HHH Sbjct: 421 HLHNHRSGGGGRHHHHHHH 439 >AF269154-1|AAF91399.1| 76|Anopheles gambiae transcription factor proboscipedia protein. Length = 76 Score = 24.2 bits (50), Expect = 4.1 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = +2 Query: 386 KKFDFNKFICQP 421 K+F FNK++C+P Sbjct: 41 KEFHFNKYLCRP 52 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 5.4 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 5/45 (11%) Frame = +2 Query: 458 YDYAYSVADPHTG-----DHKSQHESRDGGAVHGSYSLVEPDGSV 577 Y+Y + DP G D K Q+ S A + SL++PDG + Sbjct: 2682 YNYRARLYDPDIGRFYQMDPKEQYPSPYVYAGNSPVSLIDPDGEL 2726 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.8 bits (49), Expect = 5.4 Identities = 17/47 (36%), Positives = 21/47 (44%) Frame = -2 Query: 608 DGHQRCSLLYVRNHQAQRGSSYHVRHHHRGSRAGSCGHQCEGQPRSK 468 DG QR S R+ R S GSRAGS G + + RS+ Sbjct: 1059 DGSQRRSRSRSRSGSGSRSRSRSGSGSRAGSRAGS-GSRSRSRSRSR 1104 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 7.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -2 Query: 341 KRSGVDDGGSVDYRGGVDEWSCMDNGCG 258 KR GG D G E DNGCG Sbjct: 2003 KRYKQRHGGGTDASGDDLEIDACDNGCG 2030 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +2 Query: 443 QAHPKYDYAYSVADPHTGDHKSQHESRDGGAVHG 544 Q + + + A H G H +QH S G HG Sbjct: 640 QQQQQQQHQHHQAHQHQGQHHAQHHS--NGTHHG 671 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.0 bits (47), Expect = 9.5 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -2 Query: 545 YHVRHHHRGSRAGSCG 498 +H HHH G+ G G Sbjct: 123 HHHHHHHHGNNGGGNG 138 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 645,885 Number of Sequences: 2352 Number of extensions: 12295 Number of successful extensions: 40 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -