BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0972 (714 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 24 1.2 EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 22 5.0 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -2 Query: 242 VMSRGIVCRGIMTDDALGRNCRSVVVWQKTSVGGGQHGA 126 V+ R ++ + I T+D N +++ Q+ + GG GA Sbjct: 272 VLDRNVIDKWIKTEDNESLNAARMLIRQEGLLCGGSSGA 310 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 542 GSYSLVEPDGSVRKVDYTADDH 607 GS S PDG + Y AD++ Sbjct: 73 GSDSYTAPDGQQVSITYVADEN 94 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,132 Number of Sequences: 438 Number of extensions: 3671 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -