BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0971 (319 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 2.1 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 23 2.8 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 2.8 AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 23 2.8 AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 23 2.8 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 3.6 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 22 4.8 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 22 4.8 AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein prot... 22 4.8 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 22 4.8 DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor prot... 22 6.4 AJ970251-1|CAI96723.1| 131|Anopheles gambiae putative reverse t... 22 6.4 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 22 6.4 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 22 6.4 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 21 8.4 AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding pr... 21 8.4 AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding pr... 21 8.4 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -3 Query: 299 QSREQGHQDHHRGPAPRHSEKHSASEADRAERLLP 195 Q ++Q H HH + K++ + +ER+LP Sbjct: 779 QQQQQQHHHHHLQQQQQIVGKNTLYSRNSSERMLP 813 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = -3 Query: 248 HSEKHSASEADRAERLLPGALRDAPSPE*TFSTCLVSTE 132 HSE S + A+ +P ++ + FS + STE Sbjct: 431 HSESEELSMSTAADTAVPSGIKSPAFKQPAFSHSVCSTE 469 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = -3 Query: 248 HSEKHSASEADRAERLLPGALRDAPSPE*TFSTCLVSTE 132 HSE S + A+ +P ++ + FS + STE Sbjct: 431 HSESEELSMSTAADTAVPSGIKSPAFKQPAFSHSVCSTE 469 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 23.0 bits (47), Expect = 2.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 260 GLCGGPDVPAHGSAPPG 310 G+ G P +PA G +P G Sbjct: 318 GITGVPPIPADGPSPAG 334 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/25 (40%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = -3 Query: 290 EQGH-QDHHRGPAPRHSEKHSASEA 219 + GH + HH+ H HSA EA Sbjct: 223 DSGHMRSHHQHYTANHQNGHSAPEA 247 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -3 Query: 281 HQDHHRGPAPRHSEKHSAS 225 HQ HH+ P H ++H S Sbjct: 119 HQHHHQHPHLPHVQQHHPS 137 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -3 Query: 281 HQDHHRGPAPRHSEKHSASEA-DRAER 204 H D + G A ++K S SEA ++ ER Sbjct: 75 HSDRYNGEAGGRAKKQSFSEALEKIER 101 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 118 GNGVDSVETKQVEKVYSGDGASLSAPGSKRSALSAS 225 G G D + ++ EK Y G+G GS R + S+S Sbjct: 604 GGGYDRDDYRRTEKDYRGNGKH-DKYGSSRHSDSSS 638 >AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein protein. Length = 385 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -2 Query: 186 QRRPVTGINLLDLFGLDGVH 127 QR +TG N DLF LD H Sbjct: 245 QRALLTGANRYDLFLLDEHH 264 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 202 CCRERSETPRHRNKP 158 CC +RSE RN+P Sbjct: 66 CCPDRSEQLPSRNRP 80 >DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor protein. Length = 344 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -1 Query: 280 IRTTTEARRPGTARNTRRPKPTE 212 +RT+T +R GT + +P P + Sbjct: 233 LRTSTLMQRDGTLQRRTQPSPRQ 255 >AJ970251-1|CAI96723.1| 131|Anopheles gambiae putative reverse transcriptase protein. Length = 131 Score = 21.8 bits (44), Expect = 6.4 Identities = 12/45 (26%), Positives = 16/45 (35%) Frame = -1 Query: 202 CCRERSETPRHRNKPSRPVWSRRSPHHFHCSIXXXXXYNLIVVLT 68 CCR T +H P R V + HC + V+ T Sbjct: 26 CCRSLISTRQHGFFPRRSVTTNLVEFVSHCHAAFASGAQMDVIYT 70 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = -3 Query: 299 QSREQGHQDHHRGPAPRHSEKHSAS 225 Q +Q HH P S HS+S Sbjct: 1323 QQHQQHQLQHHHQPQLSQSSHHSSS 1347 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 21.8 bits (44), Expect = 6.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 285 GTSGPPQRPGAQAQR 241 G GPP PGA +++ Sbjct: 299 GPEGPPGEPGAASEK 313 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -2 Query: 285 GTSGPPQRPGAQAQRETLGVRSRQ 214 G +GPP PG R G R + Sbjct: 42 GNAGPPGAPGPVGPRGLTGHRGEK 65 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -3 Query: 251 RHSEKHSASEADRAERLLPG 192 RH SA E D +R PG Sbjct: 283 RHLSTSSADEPDACDRKAPG 302 >AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding protein AgamOBP31 protein. Length = 313 Score = 21.4 bits (43), Expect = 8.4 Identities = 5/17 (29%), Positives = 9/17 (52%) Frame = +1 Query: 226 DAECFSLCLGAGPLWWS 276 + +C C+G WW+ Sbjct: 64 ETKCLIFCVGTDLRWWN 80 >AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding protein 1 protein. Length = 304 Score = 21.4 bits (43), Expect = 8.4 Identities = 5/17 (29%), Positives = 9/17 (52%) Frame = +1 Query: 226 DAECFSLCLGAGPLWWS 276 + +C C+G WW+ Sbjct: 64 ETKCLIFCVGTDLRWWN 80 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 362,350 Number of Sequences: 2352 Number of extensions: 6822 Number of successful extensions: 33 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 21181083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -