BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0971 (319 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g12450.1 68417.m01970 expressed protein 30 0.29 At1g27060.1 68414.m03299 regulator of chromosome condensation (R... 29 0.67 At4g11610.1 68417.m01859 C2 domain-containing protein contains I... 27 2.7 At3g61940.1 68416.m06956 zinc transporter, putative similar to z... 27 2.7 At2g07630.1 68415.m00881 hypothetical protein 27 2.7 At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains... 27 2.7 At1g21630.1 68414.m02708 calcium-binding EF hand family protein ... 27 2.7 At5g53440.1 68418.m06641 expressed protein 27 3.6 At4g02230.1 68417.m00302 60S ribosomal protein L19 (RPL19C) simi... 27 3.6 At2g12100.1 68415.m01300 Ulp1 protease family protein contains P... 27 3.6 At1g45090.1 68414.m05169 Ulp1 protease family protein similar to... 27 3.6 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 26 4.8 At3g43590.1 68416.m04638 zinc knuckle (CCHC-type) family protein... 26 4.8 At3g22600.1 68416.m02855 protease inhibitor/seed storage/lipid t... 26 4.8 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 26 4.8 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 26 6.3 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 26 6.3 At5g35750.1 68418.m04281 histidine kinase (AHK2) identical to hi... 26 6.3 At4g35480.1 68417.m05042 zinc finger (C3HC4-type RING finger) fa... 26 6.3 At4g18160.1 68417.m02698 outward rectifying potassium channel, p... 26 6.3 At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, p... 26 6.3 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 26 6.3 At4g21070.1 68417.m03047 BRCT domain-containing protein / zinc f... 25 8.3 At4g15545.1 68417.m02375 expressed protein 25 8.3 At3g56720.1 68416.m06309 expressed protein 25 8.3 >At4g12450.1 68417.m01970 expressed protein Length = 277 Score = 30.3 bits (65), Expect = 0.29 Identities = 18/61 (29%), Positives = 27/61 (44%) Frame = -1 Query: 313 PPGRCRAVSRDIRTTTEARRPGTARNTRRPKPTELSACCRERSETPRHRNKPSRPVWSRR 134 P CR RD+ T +PGT + +P P+ C R E + + P+R S R Sbjct: 32 PSYSCRKNVRDVVNT----QPGTVKKNPKPDPSLRRLCSSRRPELDSNSHHPTRRSVSAR 87 Query: 133 S 131 + Sbjct: 88 A 88 >At1g27060.1 68414.m03299 regulator of chromosome condensation (RCC1) family protein low similiarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 386 Score = 29.1 bits (62), Expect = 0.67 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 248 AWAPGLCGGPDVPAHGSAP 304 +W G CGGPDV A S P Sbjct: 229 SWGRGFCGGPDVHAPQSLP 247 >At4g11610.1 68417.m01859 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1011 Score = 27.1 bits (57), Expect = 2.7 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 311 SRAVQSREQGHQDHHRGPAPRHSEKHSASEADRAERLL 198 S ++ + + H +HH P+H SE R +L+ Sbjct: 191 SSSLAAEQDNHNEHHHHYVPKHQVDEMRSEPARPSKLV 228 >At3g61940.1 68416.m06956 zinc transporter, putative similar to zinc transporter ZAT [Arabidopsis thaliana] gi|4206640|gb|AAD11757; similar to zinc transporter ZnT-2 [Rattus norvegicus] gi|1256378|gb|AAB02775; member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, PMID:11500563 Length = 334 Score = 27.1 bits (57), Expect = 2.7 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -3 Query: 284 GHQDHHRGPAPRHSEKHSASEADRAERLL 198 GH DH G HS H S +RAE+LL Sbjct: 157 GH-DHGHGHDHGHSHDHGHSYGERAEQLL 184 >At2g07630.1 68415.m00881 hypothetical protein Length = 458 Score = 27.1 bits (57), Expect = 2.7 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +1 Query: 76 QQLNCSSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPGSKRSA-LSASDAECFS 243 Q L C + +K Y + DS++ + YS + + + P SKRS+ S S A+ FS Sbjct: 369 QYLVCVENENKRYQMH--DSIDQCSLMLTYSEEPSEATTPSSKRSSDTSISPADNFS 423 >At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains ATP/GTP-binding site motif A (P-loop), PROSITE:PS00017 Length = 1340 Score = 27.1 bits (57), Expect = 2.7 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -1 Query: 265 EARRPGTARNTRRPKPTELSACCRERSETPRHRNKPSRPVWSRRSPHHFHCSI 107 E +R + R P S +ER+ P+ ++ +R RR HH SI Sbjct: 418 ERKRALEIKRDRTPTARATSKDTKERTPVPKSISRDARSSSLRRDAHHREASI 470 >At1g21630.1 68414.m02708 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain; ESTs gb|T44428 and gb|AA395440 come from this gene Length = 1218 Score = 27.1 bits (57), Expect = 2.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 315 PLPGGAEP*AGTSGPPQRP 259 P PGG P AG G P RP Sbjct: 538 PHPGGLRPPAGPKGKPPRP 556 >At5g53440.1 68418.m06641 expressed protein Length = 1181 Score = 26.6 bits (56), Expect = 3.6 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = -3 Query: 308 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRAE 207 R+++ E GH+++ R + E+H E +AE Sbjct: 550 RSIEVEETGHRNNARDYSATEEERHLVDETSQAE 583 >At4g02230.1 68417.m00302 60S ribosomal protein L19 (RPL19C) similar to L19 from several species Length = 208 Score = 26.6 bits (56), Expect = 3.6 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = -3 Query: 317 HPSRAVQSREQGHQDHHRGPAPRHSEKHSASEADRAERLLPGALRDAPS 171 H S+A ++RE+ D ++ A R ERL G D P+ Sbjct: 143 HKSKAEKAREKTLSDQFEAKRAKNKASRERKHARREERLAKGPGGDIPA 191 >At2g12100.1 68415.m01300 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At5g28270, At2g05450, At1g45090, At2g16180, At2g06750 Length = 1224 Score = 26.6 bits (56), Expect = 3.6 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 266 RGPAPRHSEKHSASEADRAERLLPGALRDAPSPE 165 R P+P H +H + E+LLP + P+ E Sbjct: 681 RVPSPSHQPEHGIPDGGNFEQLLPDPILSDPALE 714 >At1g45090.1 68414.m05169 Ulp1 protease family protein similar to At5g28270, At2g12100, At2g05450, At2g16180, At2g06750; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1210 Score = 26.6 bits (56), Expect = 3.6 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 266 RGPAPRHSEKHSASEADRAERLLPGALRDAPSPE 165 R P+P H +H + E+LLP + P+ E Sbjct: 672 RVPSPSHQPEHGIPDGGNFEQLLPDPILSDPALE 705 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 26.2 bits (55), Expect = 4.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 254 APGLCGGPDVPAHGSAPP 307 APG G P P HG PP Sbjct: 73 APGYGGYPPAPGHGGYPP 90 Score = 25.4 bits (53), Expect = 8.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 254 APGLCGGPDVPAHGSAPPGRG 316 APG G P P +G PP G Sbjct: 64 APGYGGYPPAPGYGGYPPAPG 84 >At3g43590.1 68416.m04638 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 551 Score = 26.2 bits (55), Expect = 4.8 Identities = 20/66 (30%), Positives = 25/66 (37%), Gaps = 2/66 (3%) Frame = -1 Query: 307 GRCRAVSRDIRTTTEARRPGT--ARNTRRPKPTELSACCRERSETPRHRNKPSRPVWSRR 134 G+ R I + R P T N R PK S S++ RH + PS W Sbjct: 452 GKMRRPKSPITPSGYNRSPSTHIGHNYRSPKFN--SGGHYPGSQSSRHHSGPSPSRWQPS 509 Query: 133 SPHHFH 116 HH H Sbjct: 510 HQHHHH 515 >At3g22600.1 68416.m02855 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 170 Score = 26.2 bits (55), Expect = 4.8 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = +2 Query: 215 CRLRTPSVSRCAWAPGLCGG-PDVPAH--GSAPPGRG 316 C ++TP VSRC G G D PA S+ PG G Sbjct: 95 CNVQTPPVSRCNTGGGGGGSTSDSPAESPNSSGPGNG 131 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 26.2 bits (55), Expect = 4.8 Identities = 14/46 (30%), Positives = 17/46 (36%) Frame = -1 Query: 259 RRPGTARNTRRPKPTELSACCRERSETPRHRNKPSRPVWSRRSPHH 122 RR + R P+ R ETPR WSR+ HH Sbjct: 300 RREASNELNRTPRKQVQKKSALLRLETPRSYKNSRENEWSRQHNHH 345 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 25.8 bits (54), Expect = 6.3 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = -1 Query: 298 RAVSRDIRTTTEARRPGTARNTRRPKPTELSACCR--ERSETPRHRNKPSRPVWSRRSP 128 R+ SR + + R P ++ + E+S R ERS +PR P P + SP Sbjct: 206 RSHSRSLSASPARRSPRSSSPQKTSPAREVSPDKRSNERSPSPRRSLSPRSPALQKASP 264 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 25.8 bits (54), Expect = 6.3 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = -1 Query: 298 RAVSRDIRTTTEARRPGTARNTRRPKPTELSACCR--ERSETPRHRNKPSRPVWSRRSP 128 R+ SR + + R P ++ + E+S R ERS +PR P P + SP Sbjct: 206 RSHSRSLSASPARRSPRSSSPQKTSPAREVSPDKRSNERSPSPRRSLSPRSPALQKASP 264 >At5g35750.1 68418.m04281 histidine kinase (AHK2) identical to histidine kinase AHK2 [Arabidopsis thaliana] gi|13537196|dbj|BAB40774 Length = 1176 Score = 25.8 bits (54), Expect = 6.3 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +1 Query: 82 LNCSSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPG 198 + SS S+ Y G G+ +K++ ++ G+ +S PG Sbjct: 816 MQADSSTSRTYGGTGIGLSISKRLVELMQGEMGFVSEPG 854 >At4g35480.1 68417.m05042 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain PF00097: Zinc finger, C3HC4 type (RING finger) Length = 200 Score = 25.8 bits (54), Expect = 6.3 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +2 Query: 206 AQLCRLRTPSVSRCAWAPGLCGGPDVPAHGSAPPGRG 316 A +C +V+RCAW L G + PP +G Sbjct: 36 ALVCVAGLAAVARCAWLRRLTGVNPAAVGEAPPPNKG 72 >At4g18160.1 68417.m02698 outward rectifying potassium channel, putative (KCO6) similar to kco1 [Arabidopsis thaliana] gi|2230761|emb|CAA69158; member of the 2 pore, 4 transmembrane (2P/4TM) K+ channel family, PMID:11500563 Length = 436 Score = 25.8 bits (54), Expect = 6.3 Identities = 12/30 (40%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = +3 Query: 204 ALSSVGFGRRVFLAVPGRR-ASVVVLMSLL 290 ++++VG+G R F +PGR A++ +L+S L Sbjct: 310 SVTTVGYGDRAFKTLPGRLFAAIWLLVSTL 339 >At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 224 Score = 25.8 bits (54), Expect = 6.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 196 RERSETPRHRNKPSRPVWSRRSPHH 122 R RS +P +R +PS RRSP + Sbjct: 154 RRRSPSPVYRRRPSPDYTRRRSPEY 178 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 25.8 bits (54), Expect = 6.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 196 RERSETPRHRNKPSRPVWSRRSPHH 122 R RS +P +R +PS RRSP + Sbjct: 180 RRRSPSPVYRRRPSPDYTRRRSPEY 204 >At4g21070.1 68417.m03047 BRCT domain-containing protein / zinc finger (C3HC4-type RING finger) family protein (BRCA1) contains Pfam profiles PF00533: BRCA1 C Terminus (BRCT) domain, PF00097: Zinc finger, C3HC4 type (RING finger), PF01535: PPR repeat; identical to cDNA BRCA1 GI:28372473 Length = 1276 Score = 25.4 bits (53), Expect = 8.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 287 QGHQDHHRGPAPRHSEKHSASE 222 +G QD GP+ H EK S +E Sbjct: 764 KGDQDQAHGPSDTHPEKRSPTE 785 >At4g15545.1 68417.m02375 expressed protein Length = 337 Score = 25.4 bits (53), Expect = 8.3 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = -3 Query: 251 RHSEKHSASEADRAERLLPGALRDAPSPE*TFSTCLVSTESTP 123 RHS S ++ E DAP P + S LVS +TP Sbjct: 168 RHSSIQSQQASEAIEPAATDNENDAPKPSLSASLPLVSQTTTP 210 >At3g56720.1 68416.m06309 expressed protein Length = 386 Score = 25.4 bits (53), Expect = 8.3 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 9/56 (16%) Frame = -1 Query: 274 TTTEARRP---GTARNTRRPKPTELSACC------RERSETPRHRNKPSRPVWSRR 134 TTT R+P GT+R RR + + R +S P+H K S PV R+ Sbjct: 16 TTTAFRKPSNDGTSRKYRRRALADDGSSSSDGSPERNQSPNPKHSRKDSEPVHVRK 71 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,564,710 Number of Sequences: 28952 Number of extensions: 146973 Number of successful extensions: 571 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 340508912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -