BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0970 (762 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC12C2.12c |glo1|SPBC21D10.03c|glyoxalase I |Schizosaccharomyc... 32 0.10 SPAC20G4.05c |||UPF0061 family protein|Schizosaccharomyces pombe... 27 2.2 SPAC1786.03 |cut11|SPAC24C9.01|integral membrane nucleoporin|Sch... 27 3.9 SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosacch... 26 5.1 SPCC1840.08c |||protein disulfide isomerase |Schizosaccharomyces... 25 8.9 SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces po... 25 8.9 >SPBC12C2.12c |glo1|SPBC21D10.03c|glyoxalase I |Schizosaccharomyces pombe|chr 2|||Manual Length = 302 Score = 31.9 bits (69), Expect = 0.10 Identities = 21/74 (28%), Positives = 33/74 (44%) Frame = +2 Query: 167 HFVFKVADRTLTAKFYREILGMKVLRHEEFSEGCEAACNGPYANRWSKTMVGYGPEDTHF 346 H + +V D + KFY E+ GMK++ F E E + + + G Sbjct: 14 HTMIRVKDLDKSLKFYTEVFGMKLIDQWVFEEN-EFSLSFLAFDGPGALNHGVERSKREG 72 Query: 347 VVELTYNYGVTHYE 388 ++ELTYN+G E Sbjct: 73 ILELTYNFGTEKKE 86 >SPAC20G4.05c |||UPF0061 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 568 Score = 27.5 bits (58), Expect = 2.2 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +2 Query: 590 AKSIAYWNGLLTLKLYEKTDKTALLGYSDDQAKLELVDIGEP 715 AK++A W + TD T++LG S D +D+ P Sbjct: 268 AKTVAKWQAYGFMNGVLNTDNTSILGLSIDYGPFGFLDVYNP 309 >SPAC1786.03 |cut11|SPAC24C9.01|integral membrane nucleoporin|Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 26.6 bits (56), Expect = 3.9 Identities = 9/19 (47%), Positives = 14/19 (73%), Gaps = 2/19 (10%) Frame = -3 Query: 754 RECYAPVCLCAV--YWFTN 704 R C+A +CLC + YWF++ Sbjct: 33 RACFALLCLCCITSYWFSS 51 >SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 2609 Score = 26.2 bits (55), Expect = 5.1 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +2 Query: 578 SSNLAKSIAYWNGLL-TLKLYEKTDKTALLGYS 673 S + KSI YW LL K Y+K D +LL Y+ Sbjct: 1414 SDKIIKSITYWQSLLFNSKTYQK-DLFSLLWYA 1445 >SPCC1840.08c |||protein disulfide isomerase |Schizosaccharomyces pombe|chr 3|||Manual Length = 561 Score = 25.4 bits (53), Expect = 8.9 Identities = 9/29 (31%), Positives = 20/29 (68%) Frame = +3 Query: 105 SELKS*AQSC*IAKWLAVVLFISYLKSQI 191 SE+K + I+ W++++LF+S+L ++ Sbjct: 505 SEIKQYSSLILISLWISLILFVSFLNRRL 533 >SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 851 Score = 25.4 bits (53), Expect = 8.9 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -1 Query: 159 RPLTILLFNNFELMTLVQN*VI 94 + L +L+FNN +L TL+QN ++ Sbjct: 131 KQLFLLIFNNGKLRTLLQNAIV 152 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,891,283 Number of Sequences: 5004 Number of extensions: 55834 Number of successful extensions: 139 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 138 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 365309308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -