BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0970 (762 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53877| Best HMM Match : Glyoxalase (HMM E-Value=0.58) 78 7e-15 SB_12899| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_55819| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_47844| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_50607| Best HMM Match : Vicilin_N (HMM E-Value=0.88) 28 9.5 SB_5137| Best HMM Match : Phage_integrase (HMM E-Value=0.11) 28 9.5 SB_30158| Best HMM Match : Pertactin (HMM E-Value=3.1) 28 9.5 SB_25237| Best HMM Match : Phage_integrase (HMM E-Value=0.2) 28 9.5 SB_20498| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_53877| Best HMM Match : Glyoxalase (HMM E-Value=0.58) Length = 220 Score = 78.2 bits (184), Expect = 7e-15 Identities = 35/64 (54%), Positives = 48/64 (75%) Frame = +2 Query: 569 SLASSNLAKSIAYWNGLLTLKLYEKTDKTALLGYSDDQAKLELVDIGEPINRAKAYGRIA 748 SL SNL+KS+ YWN LL ++++ +TD TA+LGY Q KLELV +G+ ++ A+GRIA Sbjct: 117 SLGVSNLSKSLEYWNKLLGMQVFSQTDTTAILGYDAKQCKLELVQVGQ-VDHGTAFGRIA 175 Query: 749 FSCP 760 FSCP Sbjct: 176 FSCP 179 Score = 55.2 bits (127), Expect = 5e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 146 MVSGRALHFVFKVADRTLTAKFYREILGMKVL 241 M S RALHFVFKVA+RT TAKFYREILGMK L Sbjct: 1 MASKRALHFVFKVANRTETAKFYREILGMKGL 32 Score = 35.5 bits (78), Expect = 0.047 Identities = 15/40 (37%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Frame = +2 Query: 407 GITVQSSESLKRAQTNNWPIKEH-NGLKYVEAPGGYKFYI 523 G+T+ S + + RA+ +N+ +++ NG V +PGGYKF++ Sbjct: 31 GLTLHSKDVVSRAKEHNYSMEQGTNGHYTVHSPGGYKFHL 70 >SB_12899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/57 (28%), Positives = 25/57 (43%) Frame = +2 Query: 239 LRHEEFSEGCEAACNGPYANRWSKTMVGYGPEDTHFVVELTYNYGVTHYEQGNDFLG 409 LRH + + N W KT D +++ TY++ V H+ + DFLG Sbjct: 518 LRHISYDQARRRIMNWDVRMEWDKTF------DDVIILDRTYHFNVIHWYKACDFLG 568 >SB_55819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2408 Score = 29.1 bits (62), Expect = 4.1 Identities = 17/57 (29%), Positives = 25/57 (43%) Frame = +2 Query: 332 EDTHFVVELTYNYGVTHYEQGNDFLGITVQSSESLKRAQTNNWPIKEHNGLKYVEAP 502 ED VE Y + +E G D L VQ S S++ + + P EH+ +P Sbjct: 2278 EDEEAFVERKYTPRKSSFEDGQDKLRDNVQYSSSVRIPKRESSPTPEHSSRYLTPSP 2334 >SB_47844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 28.7 bits (61), Expect = 5.5 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 632 LYEK-TDKTALLGYSDDQAKLELVDIGEPINRAKAYGR 742 +YEK TD GY+ D +++ V + P R AY R Sbjct: 1 MYEKKTDIETRQGYNKDTTRIQAVSVSNPSPRTAAYFR 38 >SB_50607| Best HMM Match : Vicilin_N (HMM E-Value=0.88) Length = 385 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 36 IIIHRLNNHTNNIHSLSLHRSLNSEL 113 +I+ RL+NH N H LS H + +L Sbjct: 79 LIVRRLHNHLNAKHKLSRHDEIYKQL 104 >SB_5137| Best HMM Match : Phage_integrase (HMM E-Value=0.11) Length = 834 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 36 IIIHRLNNHTNNIHSLSLHRSLNSEL 113 +I+ RL+NH N H LS H + +L Sbjct: 79 LIVRRLHNHLNAKHKLSRHDEIYKQL 104 >SB_30158| Best HMM Match : Pertactin (HMM E-Value=3.1) Length = 426 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 244 AENLHSEDFPIKFCC*SPICDFKY 173 AEN H+E +K CC S CDF Y Sbjct: 32 AENGHAE--VVKMCCESGACDFVY 53 >SB_25237| Best HMM Match : Phage_integrase (HMM E-Value=0.2) Length = 845 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 36 IIIHRLNNHTNNIHSLSLHRSLNSEL 113 +I+ RL+NH N H LS H + +L Sbjct: 79 LIVRRLHNHLNAKHKLSRHDEIYKQL 104 >SB_20498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.9 bits (59), Expect = 9.5 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = -2 Query: 356 VQQQNVYLQGHIQP--WFCSIGLHKVHCKLPRILH*TLHGGEPSFRGF 219 +Q NV +G I FC + +HKVH + H T++G + R F Sbjct: 8 MQVMNVQAKGGIALVYLFCRLPVHKVHLGVDHRKHVTVYGTRAACRAF 55 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,109,139 Number of Sequences: 59808 Number of extensions: 406629 Number of successful extensions: 874 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 806 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 873 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -