BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0968 (729 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3066| Best HMM Match : dsrm (HMM E-Value=2.2e-32) 29 2.9 SB_55828| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_35540| Best HMM Match : IF3_N (HMM E-Value=4.4e-07) 28 8.9 >SB_3066| Best HMM Match : dsrm (HMM E-Value=2.2e-32) Length = 429 Score = 29.5 bits (63), Expect = 2.9 Identities = 9/24 (37%), Positives = 19/24 (79%) Frame = -3 Query: 562 GVRRLLYRQMALCLKGTRDSPLYQ 491 G+R+ LY Q+ LC++G ++S +++ Sbjct: 345 GLRKFLYNQLELCVQGDQNSSIFE 368 >SB_55828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 112 NSPQGHVFNEAQVIGTWHPQQHKSKKTYAF 201 N P V+N QV TW +Q+ ++K Y F Sbjct: 74 NRPLRQVWNCLQVSATWINEQYSTRKKYFF 103 >SB_35540| Best HMM Match : IF3_N (HMM E-Value=4.4e-07) Length = 284 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +1 Query: 85 VHDKQQNCENSPQGHVFNEAQVIGTWHPQ--QHKSKKTYAF 201 ++D ++ ++SPQG+ E + G PQ Q K+KK + F Sbjct: 168 LYDAEKKHKHSPQGNKVKELTITGHIAPQDLQWKTKKIHGF 208 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,965,310 Number of Sequences: 59808 Number of extensions: 495731 Number of successful extensions: 2088 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1988 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2087 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -