BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0968 (729 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 24 1.3 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 22 5.2 AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 21 9.0 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 24.2 bits (50), Expect = 1.3 Identities = 18/67 (26%), Positives = 30/67 (44%) Frame = -3 Query: 370 LNNSLWLHYVCHSDKVFAFSELSSPISFCRRNSRSFLLIRFFPVR*PKLIEHIRSPRMRK 191 L S + YV ++V+ L + S + + PVR L ++ S MR Sbjct: 220 LRLSRLVRYVSQWEEVYILQNLQKKRTRAEGRLSSDNMSKKSPVRKATLFLNMASVFMRI 279 Query: 190 FSLICVV 170 F+LIC++ Sbjct: 280 FNLICMM 286 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 Query: 71 GDAFITPAANNTIRIHRRCG 12 G +ITP ++IH CG Sbjct: 311 GYKYITPLIQKHLKIHDTCG 330 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +1 Query: 523 GKEPSDGTKVDERLNKITQIYWARRH 600 G P+ TK E L + YW RH Sbjct: 85 GVGPNGLTKKQEMLVRSAIKYWVERH 110 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,945 Number of Sequences: 438 Number of extensions: 5115 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -