BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0967 (719 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL021497-13|CAA16411.2| 550|Caenorhabditis elegans Hypothetical... 31 0.83 Z81096-7|CAB03163.2| 2769|Caenorhabditis elegans Hypothetical pr... 29 2.5 Z81028-6|CAB02695.2| 2769|Caenorhabditis elegans Hypothetical pr... 29 2.5 >AL021497-13|CAA16411.2| 550|Caenorhabditis elegans Hypothetical protein Y51A2D.18 protein. Length = 550 Score = 31.1 bits (67), Expect = 0.83 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -3 Query: 423 KKHKYFVIIQI-WRSNMTIIIYRCWIKIAVKSFCHLNTF 310 KKH+ ++ + I W NM I Y W+ KS ++N F Sbjct: 210 KKHRMWINMAITWSPNMPIYSYFAWLASDWKSLAYINAF 248 >Z81096-7|CAB03163.2| 2769|Caenorhabditis elegans Hypothetical protein B0365.7 protein. Length = 2769 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = -2 Query: 496 WKSYVQYENDCKINKNRNAKKTVDKEAQIFCHNTNMAVKYDNNNL 362 WK+Y++ C+I +N NA++ + E IF H N+++ N NL Sbjct: 1315 WKNYLE-AMICRILENENAEQELVIENSIFKH-LNVSMNRKNKNL 1357 >Z81028-6|CAB02695.2| 2769|Caenorhabditis elegans Hypothetical protein B0365.7 protein. Length = 2769 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = -2 Query: 496 WKSYVQYENDCKINKNRNAKKTVDKEAQIFCHNTNMAVKYDNNNL 362 WK+Y++ C+I +N NA++ + E IF H N+++ N NL Sbjct: 1315 WKNYLE-AMICRILENENAEQELVIENSIFKH-LNVSMNRKNKNL 1357 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,447,702 Number of Sequences: 27780 Number of extensions: 287132 Number of successful extensions: 652 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 631 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 652 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1687292480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -