BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0966 (836 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 36 5e-04 DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. 23 2.6 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 8.1 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 35.9 bits (79), Expect = 5e-04 Identities = 38/165 (23%), Positives = 64/165 (38%), Gaps = 9/165 (5%) Frame = +3 Query: 348 DVKDSNFTFKAGDTIGIIPKNPQVEVDFILNHLSLTSQADLPYTLLLGNKESKIPTHVP- 524 D+ +K GD +G+ N V+ IL + D+P L + K+S P + Sbjct: 743 DIASMEILYKPGDHLGVFACNRSELVEAILKRVQTPFDPDVPIELQI-QKQSHTPNGIVK 801 Query: 525 --------VKSTLRQVXXXXXXXXXXXXXXXXXAISRYTKEDNERQVLEYLSSKEGSTAY 680 + ++LR + + E+ L L+S Y Sbjct: 802 TWIAHDRYLPNSLRILLKRFLDITTPPTPNLLRYFASIATNPKEQAQLNLLASDPA--VY 859 Query: 681 KTHILNKQINILDIFTLFPSCKPPIEVLLSYLPKLLPRPYSIVNS 815 + K N++++ FPS +P +LL +L L PR YSI +S Sbjct: 860 EDWRHWKFPNLVEVLDEFPSVRPFAPLLLLHLTPLQPRFYSISSS 904 >DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. Length = 132 Score = 23.4 bits (48), Expect = 2.6 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +3 Query: 393 GIIPKNPQVEVDFILNHLSLTSQADLPYTLLLGNKESKIPTHVPVKSTLRQV 548 GI+ KN +V+V L HL + Q T L NK I P + + V Sbjct: 67 GILDKNAEVDVQKALRHLPRSMQDS---TKKLFNKCKSIQNEDPCEKAYQLV 115 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 8.1 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +2 Query: 629 RKTSTRIFKQQGRIYSI*NSHIKQTNKH 712 R+ S R K G +Y + N H+ N H Sbjct: 262 RRDSRR--KNYGGVYHLDNHHVHHANHH 287 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,933 Number of Sequences: 438 Number of extensions: 4848 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26824317 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -