BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0965 (785 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT023884-1|ABA81818.1| 697|Drosophila melanogaster RE55168p pro... 30 4.1 AE014296-1307|AAN12047.1| 163|Drosophila melanogaster CG32375-P... 30 4.1 >BT023884-1|ABA81818.1| 697|Drosophila melanogaster RE55168p protein. Length = 697 Score = 29.9 bits (64), Expect = 4.1 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 180 SHYSTRAYREKKLLFTQLNPKQHKDSTILSPNRISIYKYFQNESEQIF 323 +H+ST + K + H T P+ + Y+YFQ++ EQIF Sbjct: 79 AHHSTTSGHAAKGQHHSPPSRIHSPPTEHHPDHVGHYEYFQHQHEQIF 126 >AE014296-1307|AAN12047.1| 163|Drosophila melanogaster CG32375-PA protein. Length = 163 Score = 29.9 bits (64), Expect = 4.1 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 180 SHYSTRAYREKKLLFTQLNPKQHKDSTILSPNRISIYKYFQNESEQIF 323 +H+ST + K + H T P+ + Y+YFQ++ EQIF Sbjct: 79 AHHSTTSGHAAKGQHHSPPSRIHSPPTEHHPDHVGHYEYFQHQHEQIF 126 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,565,797 Number of Sequences: 53049 Number of extensions: 495195 Number of successful extensions: 851 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 851 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3634208604 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -