BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0964 (759 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.6 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 22 4.6 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 6.1 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 22 6.1 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 609 SEALNTTLKPAVRYHLRTV 553 +EA TL+PA YH+R V Sbjct: 954 TEAGVFTLRPATTYHIRIV 972 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 22.2 bits (45), Expect = 4.6 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -2 Query: 461 YLLPVIGHIVSSNYNPLNRNNQSNRQIYVRIS 366 ++LP+I H + S+ NP N N + + V +S Sbjct: 212 FMLPII-HNLLSDKNPPNTENNCAQPVVVIMS 242 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.8 bits (44), Expect = 6.1 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = -2 Query: 689 TLKLAGILLWSV 654 +L LAG+++WS+ Sbjct: 352 SLNLAGVMIWSI 363 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +1 Query: 172 LDLVFRY*ISFLDLD*VRLQGYKHLPWVSNL 264 LD++ R +S L+ + GY H P +S++ Sbjct: 84 LDIMMRRDMSRLEKSPLLANGYNHSPHLSHM 114 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,008 Number of Sequences: 336 Number of extensions: 3611 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -