BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0964 (759 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC108266-1|AAI08267.1| 320|Homo sapiens heterogeneous nuclear r... 31 4.5 AL137058-3|CAI16736.1| 320|Homo sapiens protein ( Human DNA seq... 31 4.5 AB053446-1|BAB61903.2| 3434|Homo sapiens KIAA1773 protein protein. 30 7.9 >BC108266-1|AAI08267.1| 320|Homo sapiens heterogeneous nuclear ribonucleoprotein A1-like protein. Length = 320 Score = 31.1 bits (67), Expect = 4.5 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 681 ISRDPSVERSGGIGRLDESTEELVSEALNTT 589 + RDP+ +RS G G + +T E V A+NTT Sbjct: 45 VMRDPNTKRSRGFGFVTYATVEEVDAAMNTT 75 >AL137058-3|CAI16736.1| 320|Homo sapiens protein ( Human DNA sequence from clone RP11-78J21 on chromosome 13q32.2-33.3 Contains 2 novel genes, a pseudogene similar to part of TPTE and ). Length = 320 Score = 31.1 bits (67), Expect = 4.5 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 681 ISRDPSVERSGGIGRLDESTEELVSEALNTT 589 + RDP+ +RS G G + +T E V A+NTT Sbjct: 45 VMRDPNTKRSRGFGFVTYATVEEVDAAMNTT 75 >AB053446-1|BAB61903.2| 3434|Homo sapiens KIAA1773 protein protein. Length = 3434 Score = 30.3 bits (65), Expect = 7.9 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = -2 Query: 413 LNRNNQSNRQIYVRISDGGSPCQLTIRSTTRKCQLAITE 297 L+R QS+ Q+ V++ DGGSP RSTT +A+ + Sbjct: 1305 LDREQQSSYQLLVQVQDGGSP----PRSTTGTVHVAVLD 1339 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,055,064 Number of Sequences: 237096 Number of extensions: 2191949 Number of successful extensions: 4016 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3929 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4016 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 9183116696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -