BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0962 (811 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50312-6|AAL65771.1| 106|Caenorhabditis elegans Hypothetical pr... 30 1.7 Z92812-9|CAM84813.1| 338|Caenorhabditis elegans Hypothetical pr... 28 9.1 >U50312-6|AAL65771.1| 106|Caenorhabditis elegans Hypothetical protein B0222.10 protein. Length = 106 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/44 (36%), Positives = 29/44 (65%) Frame = +3 Query: 363 INLNKIYNNQTSFLTIILIIYLFVNLVAVVKITNIFYGPLRSSN 494 I++N ++NN F+T +L+I+L++ L+ V +GPLR S+ Sbjct: 52 IHIN-LFNN---FVTFLLVIFLYIFLIYYVTFFVFPFGPLRVSH 91 >Z92812-9|CAM84813.1| 338|Caenorhabditis elegans Hypothetical protein T03E6.9 protein. Length = 338 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/59 (23%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = +3 Query: 315 INKLFTKILFFNDENKINLNKIYNNQTSFLTIIL---IIYLFVNLVAVVKITNIFYGPL 482 + +FT +L + I + N Q +F I++ ++Y+ +V V I+ +FY + Sbjct: 221 VTSVFTCLLMIYESRNIVSKETLNMQRNFTGILIYQALVYIIFIIVPVAVISTLFYADI 279 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,042,027 Number of Sequences: 27780 Number of extensions: 122205 Number of successful extensions: 368 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 368 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1987863822 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -