BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0961 (768 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0152 - 27041070-27041217,27041939-27041993,27043321-27043633 65 5e-11 05_07_0155 + 28069592-28069925,28071072-28071126,28072448-28072577 64 1e-10 02_04_0314 - 21950400-21950639,21951384-21951680,21951791-219519... 28 7.1 >01_06_0152 - 27041070-27041217,27041939-27041993,27043321-27043633 Length = 171 Score = 65.3 bits (152), Expect = 5e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 760 LKNTDIAKELSLPPVKLHCSMLAEDAIKAALSDY 659 +KNT+IAK LSLPPVKLHCSMLAEDAIKAA+ DY Sbjct: 120 IKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDY 153 >05_07_0155 + 28069592-28069925,28071072-28071126,28072448-28072577 Length = 172 Score = 64.1 bits (149), Expect = 1e-10 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 760 LKNTDIAKELSLPPVKLHCSMLAEDAIKAALSDYRINQQTENK 632 +KN++IAK LSLPPVKLHCSMLAEDAIKAA+ DY + +K Sbjct: 127 IKNSEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKKAKLDK 169 >02_04_0314 - 21950400-21950639,21951384-21951680,21951791-21951920, 21952377-21952699,21953385-21953606,21953693-21954089, 21954488-21954540 Length = 553 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -3 Query: 754 NTDIAKELSLPPVKLHCSMLAEDAIKAALSDYRINQQTEN 635 + D+A LPP + C ++ ED A L R+ + EN Sbjct: 282 SVDLAMLAGLPPAAVLCEIVDEDGSMARLPKLRVFAEREN 321 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,836,405 Number of Sequences: 37544 Number of extensions: 240417 Number of successful extensions: 357 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 357 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -